Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|7316
Gene name
LocationContig_419:4494..6536
Strand+
Gene length (bp)2042
Transcript length (bp)1845
Coding sequence length (bp)1845
Protein length (aa) 615

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01424 R3H R3H domain 2.6E-09 327 380
PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) 1.4E-04 182 252

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q09868|CIP2_SCHPO RNA-binding post-transcriptional regulator cip2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cip2 PE=1 SV=1 175 378 5.0E-50
sp|P34217|PIN4_YEAST RNA-binding protein PIN4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PIN4 PE=1 SV=1 175 283 1.0E-38
sp|O42923|CIP1_SCHPO RNA-binding post-transcriptional regulator cip1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cip1 PE=1 SV=1 174 378 7.0E-38

GO

GO Term Description Terminal node
GO:0003723 RNA binding Yes
GO:0003676 nucleic acid binding Yes
GO:0097159 organic cyclic compound binding No
GO:0005488 binding No
GO:1901363 heterocyclic compound binding No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 70 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|7316
MSQQPHDLGYLDYSSPANRSPGSSRQNYGGGAFASGLSLPRQTQRPFDAPLGSSALYPTDRITGAFNPRAMENMT
LAAGMHGGYMLDNGANWSYNASGVATVNGNIHGPNRQRSVNRRAALPQNWTDHAAMSMPATLQPFPTSLNGGHLS
NGGLRVDQGPSHTSPDLRSTASDGDQLIPTAIVIKNIPFAVRKETLTSIMLEMNLPQPYAFNYHFDNGVFRGLAF
ANFQSAEDTRVVIDAMNGMDVHGRKLRVEYKKMLPEAERERIEREKRERRGQLEEQHRAPMLHNQSSLQSLGGMS
QTQQRAPAGHLGDVDLNDPQTLEFYTELVMFKRDDTREVLVFPPSIIPEHRRSIHILAHHMGLEHQSMGEADSRQ
LTVLKRQQPSPTTNVQNAAVANSLDMHKRGLSRAATFDFAADRESRAASSNYAHVLGRQGPTLELPGSPDGSGIP
NNLRAAKSFADLRSFTPSPSQASSSYLAPGAGVGSIGPGSTARFGDYMGHVQPVSHPGTSGTPGPKGDHGLVAGL
GSLSLSPFDPNSMQTQTRNAPGAIGSQRPGAGGGGGKNAPERQPRGPEWETSAGFGGRTGPNGHAQRGSDSSDNG
ARVPQSSTGAPRYH*
Coding >Hirsu2|7316
ATGAGCCAACAACCTCACGACTTGGGCTACTTGGACTACTCATCCCCCGCCAACCGCTCTCCCGGCTCCTCCAGG
CAGAACTATGGCGGTGGCGCTTTCGCCTCGGGCCTGTCGCTGCCCCGACAAACGCAGCGCCCCTTCGACGCCCCC
CTGGGCTCCTCTGCACTCTATCCCACCGACAGAATAACCGGCGCCTTCAACCCCAGGGCCATGGAGAACATGACG
CTTGCCGCCGGCATGCACGGCGGCTACATGCTCGACAACGGCGCCAACTGGAGCTATAACGCCTCGGGCGTCGCC
ACCGTCAACGGCAACATCCACGGGCCCAACCGCCAGCGCAGCGTCAACCGACGCGCCGCCCTGCCCCAAAACTGG
ACTGATCACGCCGCCATGAGCATGCCCGCCACCCTGCAACCCTTCCCCACCAGCCTCAACGGCGGCCACCTGTCC
AACGGCGGCCTTCGCGTCGACCAGGGTCCGTCGCACACCTCGCCCGATCTCCGCTCGACCGCCTCGGATGGCGAC
CAGCTCATCCCCACGGCCATCGTCATCAAGAACATACCCTTTGCCGTCCGGAAGGAGACACTGACGTCCATCATG
CTCGAGATGAACCTCCCCCAGCCCTACGCCTTCAACTACCACTTTGACAATGGCGTCTTTCGTGGCCTGGCCTTT
GCCAACTTCCAGTCCGCCGAGGACACCCGGGTCGTCATCGACGCCATGAACGGCATGGACGTCCACGGCCGCAAG
CTGCGCGTCGAGTACAAGAAGATGCTGCCCGAGGCGGAGCGCGAACGCATCGAGCGGGAGAAGCGAGAGAGGCGT
GGTCAGCTCGAGGAGCAGCATCGCGCGCCCATGCTCCACAACCAGAGCTCCCTGCAGTCGCTCGGCGGCATGTCC
CAGACGCAGCAGAGGGCCCCGGCGGGACACCTGGGTGACGTCGACCTCAACGACCCCCAGACTCTCGAATTCTAC
ACCGAGCTGGTCATGTTCAAGCGCGACGACACGCGTGAAGTCCTTGTCTTTCCCCCGAGCATCATCCCGGAGCAC
CGGCGCTCCATTCACATCCTCGCGCACCATATGGGGCTGGAGCATCAGTCGATGGGAGAGGCCGACTCGAGGCAG
CTCACCGTCCTCAAGCGGCAACAGCCCTCCCCGACGACCAATGTGCAAAACGCCGCCGTGGCCAACAGCCTCGAC
ATGCACAAGCGGGGGCTGAGCCGGGCCGCCACCTTCGACTTCGCCGCCGACCGGGAGTCGCGTGCCGCCAGCAGC
AACTATGCTCATGTGCTGGGCCGGCAGGGGCCCACCCTCGAGCTCCCCGGGAGCCCGGACGGCAGCGGGATCCCC
AACAATCTCCGTGCGGCTAAGAGCTTTGCCGACCTCCGATCCTTCACCCCGAGCCCGTCGCAGGCCTCGTCCAGC
TACCTGGCTCCCGGGGCTGGTGTGGGTAGCATCGGACCGGGGTCGACGGCCCGATTCGGCGACTACATGGGCCAC
GTCCAGCCTGTGTCCCATCCGGGGACATCGGGAACGCCCGGCCCCAAGGGCGACCACGGCCTCGTTGCCGGCCTC
GGGAGCCTGAGCCTCAGCCCCTTCGACCCCAACTCGATGCAGACCCAGACGCGCAACGCCCCCGGCGCCATCGGT
AGCCAGAGGCCCGGGGCCGGCGGCGGCGGCGGCAAGAACGCGCCGGAGAGGCAGCCCCGCGGTCCCGAGTGGGAG
ACGTCGGCCGGCTTCGGCGGCCGGACCGGACCAAACGGCCACGCACAGCGAGGCAGCGATTCCTCCGACAACGGC
GCTCGCGTGCCCCAAAGCTCGACGGGTGCCCCGAGGTACCACTAA
Transcript >Hirsu2|7316
ATGAGCCAACAACCTCACGACTTGGGCTACTTGGACTACTCATCCCCCGCCAACCGCTCTCCCGGCTCCTCCAGG
CAGAACTATGGCGGTGGCGCTTTCGCCTCGGGCCTGTCGCTGCCCCGACAAACGCAGCGCCCCTTCGACGCCCCC
CTGGGCTCCTCTGCACTCTATCCCACCGACAGAATAACCGGCGCCTTCAACCCCAGGGCCATGGAGAACATGACG
CTTGCCGCCGGCATGCACGGCGGCTACATGCTCGACAACGGCGCCAACTGGAGCTATAACGCCTCGGGCGTCGCC
ACCGTCAACGGCAACATCCACGGGCCCAACCGCCAGCGCAGCGTCAACCGACGCGCCGCCCTGCCCCAAAACTGG
ACTGATCACGCCGCCATGAGCATGCCCGCCACCCTGCAACCCTTCCCCACCAGCCTCAACGGCGGCCACCTGTCC
AACGGCGGCCTTCGCGTCGACCAGGGTCCGTCGCACACCTCGCCCGATCTCCGCTCGACCGCCTCGGATGGCGAC
CAGCTCATCCCCACGGCCATCGTCATCAAGAACATACCCTTTGCCGTCCGGAAGGAGACACTGACGTCCATCATG
CTCGAGATGAACCTCCCCCAGCCCTACGCCTTCAACTACCACTTTGACAATGGCGTCTTTCGTGGCCTGGCCTTT
GCCAACTTCCAGTCCGCCGAGGACACCCGGGTCGTCATCGACGCCATGAACGGCATGGACGTCCACGGCCGCAAG
CTGCGCGTCGAGTACAAGAAGATGCTGCCCGAGGCGGAGCGCGAACGCATCGAGCGGGAGAAGCGAGAGAGGCGT
GGTCAGCTCGAGGAGCAGCATCGCGCGCCCATGCTCCACAACCAGAGCTCCCTGCAGTCGCTCGGCGGCATGTCC
CAGACGCAGCAGAGGGCCCCGGCGGGACACCTGGGTGACGTCGACCTCAACGACCCCCAGACTCTCGAATTCTAC
ACCGAGCTGGTCATGTTCAAGCGCGACGACACGCGTGAAGTCCTTGTCTTTCCCCCGAGCATCATCCCGGAGCAC
CGGCGCTCCATTCACATCCTCGCGCACCATATGGGGCTGGAGCATCAGTCGATGGGAGAGGCCGACTCGAGGCAG
CTCACCGTCCTCAAGCGGCAACAGCCCTCCCCGACGACCAATGTGCAAAACGCCGCCGTGGCCAACAGCCTCGAC
ATGCACAAGCGGGGGCTGAGCCGGGCCGCCACCTTCGACTTCGCCGCCGACCGGGAGTCGCGTGCCGCCAGCAGC
AACTATGCTCATGTGCTGGGCCGGCAGGGGCCCACCCTCGAGCTCCCCGGGAGCCCGGACGGCAGCGGGATCCCC
AACAATCTCCGTGCGGCTAAGAGCTTTGCCGACCTCCGATCCTTCACCCCGAGCCCGTCGCAGGCCTCGTCCAGC
TACCTGGCTCCCGGGGCTGGTGTGGGTAGCATCGGACCGGGGTCGACGGCCCGATTCGGCGACTACATGGGCCAC
GTCCAGCCTGTGTCCCATCCGGGGACATCGGGAACGCCCGGCCCCAAGGGCGACCACGGCCTCGTTGCCGGCCTC
GGGAGCCTGAGCCTCAGCCCCTTCGACCCCAACTCGATGCAGACCCAGACGCGCAACGCCCCCGGCGCCATCGGT
AGCCAGAGGCCCGGGGCCGGCGGCGGCGGCGGCAAGAACGCGCCGGAGAGGCAGCCCCGCGGTCCCGAGTGGGAG
ACGTCGGCCGGCTTCGGCGGCCGGACCGGACCAAACGGCCACGCACAGCGAGGCAGCGATTCCTCCGACAACGGC
GCTCGCGTGCCCCAAAGCTCGACGGGTGCCCCGAGGTACCACTAA
Gene >Hirsu2|7316
ATGAGCCAACAACCTCACGACTTGGGCTACTTGGACTACTCATCCCCCGCCAACCGCTCTCCCGGCTCCTCCAGG
CAGAACTATGGCGGTGGCGCTTTCGCCTCGGGCCTGTCGCTGCCCCGACAAACGCAGCGCCCCTTCGACGCCCCC
CTGGGCTCCTCTGCACTCTATCCCACCGACAGAATAACCGGCGCCTTCAACCCCAGGGCCATGGAGAACATGACG
CTTGCCGCCGGCATGCACGGCGGCTACATGCTCGACAACGGCGCCAACTGGAGCTATAACGCCTCGGGCGTCGCC
ACCGTCAACGGCAACATCCACGGGCCCAACCGCCAGCGCAGCGTCAACCGACGCGCCGCCCTGCCCCAAGTGCGT
AGCCCGCAACGCCTGCTGAATGACGACGTGCTGACCGCCCGCTCCGTAGAACTGGACTGATCACGCCGCCATGAG
CATGCCCGCCACCCTGCAACCCTTCCCCACCAGCCTCAACGGCGGCCACCTGTCCAACGGCGGCCTTCGCGTCGA
CCAGGGTCCGTCGCACACCTCGCCCGATCTCCGCTCGACCGCCTCGGATGGCGACCAGCTCATCCCCACGGCCAT
CGTCATCAAGAACATACCCTTTGCCGTCCGGAAGGAGACACTGACGTCCATCATGCTCGAGATGAACCTCCCCCA
GCCCTACGCCTTCAACTACCACTTTGACAATGGCGTCTTTCGTGGCCTGGCCTTTGCCAACTTCCAGTCCGCCGA
GGACACCCGGGTCGTCATCGACGCCATGAACGGCATGGACGTCCACGGCCGCAAGCTGCGCGTCGAGTACAAGAA
GATGCTGCCCGAGGCGGAGCGCGAACGCATCGAGCGGGAGAAGCGAGAGAGGCGTGGTCAGCTCGAGGAGCAGCA
TCGCGCGCCCATGCTCCACAACCAGAGCTCCCTGCAGTCGCTCGGCGGCATGTCCCAGACGCAGCAGAGGGCCCC
GGCGGGACACCTGGGTACGCTCTCCCCCTCCCCTCGGCCCGCCAAGCCAAGGCAAAGCCCCGTGCCGTTTCTCAC
CCCTCATACCCTCTCCGCAGGTGACGTCGACCTCAACGACCCCCAGACTCTCGAATTCTACACCGAGCTGGTCAT
GTTCAAGCGCGACGACACGCGTGAAGTCCTTGTCTTTCCCCCGAGCATCATCCCGGAGCACCGGCGCTCCATTCA
CATCCTCGCGCACCATATGGGGCTGGAGCATCAGTCGATGGGAGAGGCCGACTCGAGGCAGCTCACCGTCCTCAA
GCGGCAACAGCCCTCCCCGACGACCAATGTGCAAAACGCCGCCGTGGCCAACAGCCTCGACATGCACAAGCGGGG
GCTGAGCCGGGCCGCCACCTTCGACTTCGCCGCCGACCGGGAGTCGCGTGCCGCCAGCAGCAACTATGCTCATGT
GCTGGGCCGGCAGGGGCCCACCCTCGAGCTCCCCGGGAGCCCGGACGGCAGCGGGATCCCCAACAATCTCCGTGC
GGCTAAGAGCTTTGCCGACCTCCGATCCTTCACCCCGAGCCCGTCGCAGGCCTCGTCCAGCTACCTGGCTCCCGG
GGCTGGTGTGGGTAGCATCGGACCGGGGTCGACGGCCCGATTCGGCGACTACATGGGCCACGTCCAGCCTGTGTC
CCATCCGGGGACATCGGGAACGCCCGGCCCCAAGGGCGACCACGGCCTCGTTGCCGGCCTCGGGAGCCTGAGCCT
CAGCCCCTTCGACCCCAACTCGATGCAGACCCAGACGCGCAACGCCCCCGGCGCCATCGGTAGCCAGAGGCCCGG
GGCCGGCGGCGGCGGCGGCAAGAACGCGCCGGAGAGGCAGCCCCGCGGTCCCGAGTGGGAGACGTCGGCCGGCTT
CGGCGGCCGGACCGGACCAAACGGCCACGCACAGCGAGGCAGCGGTATGTAGTCGACGCGTCCGGCACGTGACAC
GGGGTCGCGCTCATCAACCAGTCGCTTCAGATTCCTCCGACAACGGCGCTCGCGTGCCCCAAAGCTCGACGGGTG
CCCCGAGGTACCACTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail