Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|7311
Gene name
LocationContig_417:19487..20008
Strand-
Gene length (bp)521
Transcript length (bp)384
Coding sequence length (bp)384
Protein length (aa) 128

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|C9SNH6|LCL2_VERA1 Long chronological lifespan protein 2 OS=Verticillium alfalfae (strain VaMs.102 / ATCC MYA-4576 / FGSC 10136) GN=LCL2 PE=3 SV=1 1 127 1.0E-47
sp|C7Z403|LCL2_NECH7 Long chronological lifespan protein 2 OS=Nectria haematococca (strain 77-13-4 / ATCC MYA-4622 / FGSC 9596 / MPVI) GN=LCL2 PE=3 SV=1 19 127 3.0E-46
sp|E3QVL2|LCL2_COLGM Long chronological lifespan protein 2 OS=Colletotrichum graminicola (strain M1.001 / M2 / FGSC 10212) GN=LCL2 PE=3 SV=1 7 127 5.0E-45
sp|Q2U9Z3|LCL2_ASPOR Long chronological lifespan protein 2 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=lcl2 PE=3 SV=1 10 127 6.0E-45
sp|B8NQK0|LCL2_ASPFN Long chronological lifespan protein 2 OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=lcl2 PE=3 SV=1 10 127 6.0E-45
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|C9SNH6|LCL2_VERA1 Long chronological lifespan protein 2 OS=Verticillium alfalfae (strain VaMs.102 / ATCC MYA-4576 / FGSC 10136) GN=LCL2 PE=3 SV=1 1 127 1.0E-47
sp|C7Z403|LCL2_NECH7 Long chronological lifespan protein 2 OS=Nectria haematococca (strain 77-13-4 / ATCC MYA-4622 / FGSC 9596 / MPVI) GN=LCL2 PE=3 SV=1 19 127 3.0E-46
sp|E3QVL2|LCL2_COLGM Long chronological lifespan protein 2 OS=Colletotrichum graminicola (strain M1.001 / M2 / FGSC 10212) GN=LCL2 PE=3 SV=1 7 127 5.0E-45
sp|Q2U9Z3|LCL2_ASPOR Long chronological lifespan protein 2 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=lcl2 PE=3 SV=1 10 127 6.0E-45
sp|B8NQK0|LCL2_ASPFN Long chronological lifespan protein 2 OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=lcl2 PE=3 SV=1 10 127 6.0E-45
sp|B8M9Q9|LCL2_TALSN Long chronological lifespan protein 2 OS=Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006) GN=lcl2 PE=3 SV=1 10 127 1.0E-41
sp|Q0CE76|LCL2_ASPTN Long chronological lifespan protein 2 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=lcl2 PE=3 SV=1 11 127 2.0E-41
sp|Q0UAF6|LCL2_PHANO Long chronological lifespan protein 2 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=LCL2 PE=3 SV=1 1 127 2.0E-41
sp|A1C4T4|LCL2_ASPCL Long chronological lifespan protein 2 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=lcl2 PE=3 SV=1 1 127 9.0E-41
sp|A1CZR3|LCL2_NEOFI Long chronological lifespan protein 2 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=lcl2 PE=3 SV=1 10 127 2.0E-40
sp|Q4WES5|LCL2_ASPFU Long chronological lifespan protein 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=lcl2 PE=3 SV=1 10 127 4.0E-40
sp|B0Y310|LCL2_ASPFC Long chronological lifespan protein 2 OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=lcl2 PE=3 SV=1 10 127 4.0E-40
sp|B2ABT3|LCL2_PODAN Long chronological lifespan protein 2 OS=Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) GN=LCL2 PE=3 SV=1 13 127 3.0E-39
sp|B6HU36|LCL2_PENRW Long chronological lifespan protein 2 OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) GN=lcl2 PE=3 SV=1 11 127 8.0E-39
sp|C5FVJ9|LCL2_ARTOC Long chronological lifespan protein 2 OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=LCL2 PE=3 SV=1 7 127 2.0E-38
sp|Q8X0Q1|LCL2_NEUCR Long chronological lifespan protein 2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=lcl2 PE=3 SV=1 16 127 5.0E-38
sp|D1ZMX7|LCL2_SORMK Long chronological lifespan protein 2 OS=Sordaria macrospora (strain ATCC MYA-333 / DSM 997 / K(L3346) / K-hell) GN=LCL2 PE=3 SV=1 16 127 1.0E-37
sp|A2QUM3|LCL2_ASPNC Long chronological lifespan protein 2 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=lcl2 PE=3 SV=1 16 127 1.0E-37
sp|E4UUB3|LCL2_ARTGP Long chronological lifespan protein 2 OS=Arthroderma gypseum (strain ATCC MYA-4604 / CBS 118893) GN=LCL2 PE=3 SV=1 15 127 5.0E-37
sp|A4QUA4|LCL2_MAGO7 Long chronological lifespan protein 2 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=LCL2 PE=3 SV=1 45 127 4.0E-36
sp|A6RPX6|LCL2_BOTFB Long chronological lifespan protein 2 OS=Botryotinia fuckeliana (strain B05.10) GN=lcl2 PE=3 SV=1 18 127 1.0E-35
sp|C0NTV7|LCL2_AJECG Long chronological lifespan protein 2 OS=Ajellomyces capsulatus (strain G186AR / H82 / ATCC MYA-2454 / RMSCC 2432) GN=LCL2 PE=3 SV=1 20 127 1.0E-35
sp|B6QFV5|LCL2_TALMQ Long chronological lifespan protein 2 OS=Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333) GN=lcl2 PE=3 SV=1 10 127 3.0E-35
sp|C6HEL8|LCL2_AJECH Long chronological lifespan protein 2 OS=Ajellomyces capsulatus (strain H143) GN=LCL2 PE=3 SV=1 20 127 3.0E-35
sp|A6QTA3|LCL2_AJECN Long chronological lifespan protein 2 OS=Ajellomyces capsulatus (strain NAm1 / WU24) GN=LCL2 PE=3 SV=1 20 127 3.0E-35
sp|A7E987|LCL2_SCLS1 Long chronological lifespan protein 2 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=lcl2 PE=3 SV=1 18 127 2.0E-34
sp|C1GJL9|LCL2_PARBD Long chronological lifespan protein 2 OS=Paracoccidioides brasiliensis (strain Pb18) GN=LCL2 PE=3 SV=1 20 127 1.0E-33
sp|C0S855|LCL2_PARBP Long chronological lifespan protein 2 OS=Paracoccidioides brasiliensis (strain Pb03) GN=LCL2 PE=3 SV=1 20 127 1.0E-33
sp|C1H0A6|LCL2_PARBA Long chronological lifespan protein 2 OS=Paracoccidioides lutzii (strain ATCC MYA-826 / Pb01) GN=LCL2 PE=3 SV=1 20 127 1.0E-33
sp|C5JF45|LCL2_AJEDS Long chronological lifespan protein 2 OS=Ajellomyces dermatitidis (strain SLH14081) GN=LCL2 PE=3 SV=1 18 127 4.0E-33
sp|C5GHR3|LCL2_AJEDR Long chronological lifespan protein 2 OS=Ajellomyces dermatitidis (strain ER-3 / ATCC MYA-2586) GN=LCL2 PE=3 SV=1 18 127 4.0E-33
sp|E3RT14|LCL2_PYRTT Long chronological lifespan protein 2 OS=Pyrenophora teres f. teres (strain 0-1) GN=lcl2 PE=3 SV=1 20 127 1.0E-32
sp|E5A960|LCL2_LEPMJ Long chronological lifespan protein 2 OS=Leptosphaeria maculans (strain JN3 / isolate v23.1.3 / race Av1-4-5-6-7-8) GN=LCL2 PE=3 SV=1 52 127 1.0E-29
sp|B2WHK5|LCL2_PYRTR Long chronological lifespan protein 2 OS=Pyrenophora tritici-repentis (strain Pt-1C-BFP) GN=lcl2 PE=3 SV=1 52 127 9.0E-29
sp|B9WM02|LCL2_CANDC Long chronological lifespan protein 2 OS=Candida dubliniensis (strain CD36 / ATCC MYA-646 / CBS 7987 / NCPF 3949 / NRRL Y-17841) GN=LCL2 PE=3 SV=1 9 107 3.0E-11
sp|C4YM26|LCL2_CANAW Long chronological lifespan protein 2 OS=Candida albicans (strain WO-1) GN=LCL2 PE=3 SV=1 9 107 5.0E-11
sp|Q59PT4|LCL2_CANAL Long chronological lifespan protein 2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=LCL2 PE=3 SV=1 9 107 5.0E-11
sp|C5M3K2|LCL2_CANTT Long chronological lifespan protein 2 OS=Candida tropicalis (strain ATCC MYA-3404 / T1) GN=LCL2 PE=3 SV=1 9 107 1.0E-09
sp|A5DP59|LCL2_PICGU Long chronological lifespan protein 2 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=LCL2 PE=3 SV=1 1 107 1.0E-09
sp|C4YAT5|LCL2_CLAL4 Long chronological lifespan protein 2 OS=Clavispora lusitaniae (strain ATCC 42720) GN=LCL2 PE=3 SV=1 41 107 5.0E-08
sp|A3LY18|LCL2_PICST Long chronological lifespan protein 2 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=LCL2 PE=3 SV=1 3 107 6.0E-08
sp|A7TJ20|LCL2_VANPO Long chronological lifespan protein 2 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=LCL2 PE=3 SV=1 66 120 8.0E-07
sp|A5E0N1|LCL2_LODEL Long chronological lifespan protein 2 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=LCL2 PE=3 SV=1 63 109 9.0E-07
sp|C4R2P5|LCL2_PICPG Long chronological lifespan protein 2 OS=Komagataella pastoris (strain GS115 / ATCC 20864) GN=LCL2 PE=3 SV=1 9 127 1.0E-06
sp|C5DVG0|LCL2_ZYGRC Long chronological lifespan protein 2 OS=Zygosaccharomyces rouxii (strain ATCC 2623 / CBS 732 / NBRC 1130 / NCYC 568 / NRRL Y-229) GN=LCL2 PE=3 SV=1 51 109 1.0E-06
sp|Q6BNN2|LCL2_DEBHA Long chronological lifespan protein 2 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=LCL2 PE=3 SV=1 66 107 2.0E-06
sp|Q6CFG3|LCL2_YARLI Long chronological lifespan protein 2 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=LCL2 PE=3 SV=1 10 124 2.0E-06
sp|Q08045|LCL2_YEAST Long chronological lifespan protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LCL2 PE=1 SV=1 57 107 2.0E-06
sp|C8ZD75|LCL2_YEAS8 Long chronological lifespan protein 2 OS=Saccharomyces cerevisiae (strain Lalvin EC1118 / Prise de mousse) GN=LCL2 PE=3 SV=1 57 107 2.0E-06
sp|A7A108|LCL2_YEAS7 Long chronological lifespan protein 2 OS=Saccharomyces cerevisiae (strain YJM789) GN=LCL2 PE=3 SV=1 57 107 2.0E-06
sp|C7GQS7|LCL2_YEAS2 Long chronological lifespan protein 2 OS=Saccharomyces cerevisiae (strain JAY291) GN=LCL2 PE=3 SV=1 57 107 2.0E-06
sp|B3LT72|LCL2_YEAS1 Long chronological lifespan protein 2 OS=Saccharomyces cerevisiae (strain RM11-1a) GN=LCL2 PE=3 SV=1 57 107 2.0E-06
sp|C5DMZ6|LCL2_LACTC Long chronological lifespan protein 2 OS=Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284) GN=LCL2 PE=3 SV=1 8 107 2.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 21 0.45

Transmembrane Domains

Domain # Start End Length
1 7 25 18

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|7311
MHQVQLVSLVLLSLLSLASAQFGFFEQMFGGGGGGGGGGGHEAHQQQRMNPSDSSLYRGRYSEALCDRYLCPDTL
ACVHFPHHCPCAWDANEDKFELGDGKRVCVSKGGFRPGEAARKVELARKGLL*
Coding >Hirsu2|7311
ATGCATCAAGTCCAACTCGTCTCCCTCGTCCTCCTCTCGCTCCTCTCCCTCGCGTCCGCCCAGTTCGGCTTTTTC
GAGCAGATGTTCGGCGGTGGCGGCGGCGGCGGCGGCGGAGGCGGCCACGAGGCGCACCAGCAGCAGCGCATGAAC
CCCAGCGACTCGTCGCTCTACCGCGGCCGCTACTCCGAAGCCCTCTGCGATCGCTACCTCTGCCCCGACACCCTC
GCCTGCGTCCACTTCCCGCATCACTGCCCCTGCGCCTGGGACGCCAACGAGGACAAGTTCGAGCTGGGCGACGGC
AAGCGCGTCTGCGTCTCCAAGGGCGGTTTCCGGCCCGGCGAGGCCGCGCGCAAGGTCGAGCTGGCGCGCAAGGGG
CTGCTATAG
Transcript >Hirsu2|7311
ATGCATCAAGTCCAACTCGTCTCCCTCGTCCTCCTCTCGCTCCTCTCCCTCGCGTCCGCCCAGTTCGGCTTTTTC
GAGCAGATGTTCGGCGGTGGCGGCGGCGGCGGCGGCGGAGGCGGCCACGAGGCGCACCAGCAGCAGCGCATGAAC
CCCAGCGACTCGTCGCTCTACCGCGGCCGCTACTCCGAAGCCCTCTGCGATCGCTACCTCTGCCCCGACACCCTC
GCCTGCGTCCACTTCCCGCATCACTGCCCCTGCGCCTGGGACGCCAACGAGGACAAGTTCGAGCTGGGCGACGGC
AAGCGCGTCTGCGTCTCCAAGGGCGGTTTCCGGCCCGGCGAGGCCGCGCGCAAGGTCGAGCTGGCGCGCAAGGGG
CTGCTATAG
Gene >Hirsu2|7311
ATGCATCAAGTCCAACTCGTCTCCCTCGTCCTCCTCTCGCTCCTCTCCCTCGCGTCCGCCCAGTTCGGCTTTTTC
GAGCAGATGTTCGGCGGTGGCGGCGGCGGCGGCGGCGGAGGCGGCCACGAGGCGCACCAGCAGCAGCGCATGAAC
CCCAGCGACTCGTCGCTCTACCGCGGCCGCTACTCCGAAGGCACGCACGCTCCCTTTCGCCTTTCGTCTCCCTCA
ATCGCCTCTCTTGTTGGACGGCGGCTTGCGCCGGCAGTTCCCCCCCTTCATCTCCCAAGAATAAAGAAAGTAAGA
AAGCTAACACTCCGTCAACAAAAAAAGCCCTCTGCGATCGCTACCTCTGCCCCGACACCCTCGCCTGCGTCCACT
TCCCGCATCACTGCCCCTGCGCCTGGGACGCCAACGAGGACAAGTTCGAGCTGGGCGACGGCAAGCGCGTCTGCG
TCTCCAAGGGCGGTTTCCGGCCCGGCGAGGCCGCGCGCAAGGTCGAGCTGGCGCGCAAGGGGCTGCTATAG

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail