Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|7302
Gene name
LocationContig_416:8574..10558
Strand+
Gene length (bp)1984
Transcript length (bp)1866
Coding sequence length (bp)1866
Protein length (aa) 622

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03441 FAD_binding_7 FAD binding domain of DNA photolyase 2.4E-76 318 546
PF00875 DNA_photolyase DNA photolyase 5.7E-36 6 159

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q8QG60|CRY2_CHICK Cryptochrome-2 OS=Gallus gallus GN=CRY2 PE=2 SV=2 5 550 7.0E-122
sp|Q923I8|CRY2_RAT Cryptochrome-2 OS=Rattus norvegicus GN=Cry2 PE=1 SV=1 7 550 9.0E-121
sp|Q16526|CRY1_HUMAN Cryptochrome-1 OS=Homo sapiens GN=CRY1 PE=1 SV=1 7 549 3.0E-120
sp|Q9R194|CRY2_MOUSE Cryptochrome-2 OS=Mus musculus GN=Cry2 PE=1 SV=1 7 550 4.0E-120
sp|Q8WP19|CRY1_MACFA Cryptochrome-1 OS=Macaca fascicularis GN=CRY1 PE=2 SV=1 7 549 6.0E-120
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q8QG60|CRY2_CHICK Cryptochrome-2 OS=Gallus gallus GN=CRY2 PE=2 SV=2 5 550 7.0E-122
sp|Q923I8|CRY2_RAT Cryptochrome-2 OS=Rattus norvegicus GN=Cry2 PE=1 SV=1 7 550 9.0E-121
sp|Q16526|CRY1_HUMAN Cryptochrome-1 OS=Homo sapiens GN=CRY1 PE=1 SV=1 7 549 3.0E-120
sp|Q9R194|CRY2_MOUSE Cryptochrome-2 OS=Mus musculus GN=Cry2 PE=1 SV=1 7 550 4.0E-120
sp|Q8WP19|CRY1_MACFA Cryptochrome-1 OS=Macaca fascicularis GN=CRY1 PE=2 SV=1 7 549 6.0E-120
sp|Q32Q86|CRY1_RAT Cryptochrome-1 OS=Rattus norvegicus GN=Cry1 PE=1 SV=1 7 549 1.0E-119
sp|Q6ZZY0|CRY1_SYLBO Cryptochrome-1 OS=Sylvia borin GN=CRY1 PE=2 SV=1 7 549 4.0E-119
sp|P97784|CRY1_MOUSE Cryptochrome-1 OS=Mus musculus GN=Cry1 PE=1 SV=1 7 549 4.0E-119
sp|Q49AN0|CRY2_HUMAN Cryptochrome-2 OS=Homo sapiens GN=CRY2 PE=1 SV=2 7 550 4.0E-119
sp|Q8QG61|CRY1_CHICK Cryptochrome-1 OS=Gallus gallus GN=CRY1 PE=2 SV=1 7 549 5.0E-119
sp|Q5IZC5|CRY1_ERIRU Cryptochrome-1 OS=Erithacus rubecula GN=CRY1 PE=2 SV=2 7 549 3.0E-118
sp|Q70AD6|CRY1_SPAJD Cryptochrome-1 OS=Spalax judaei GN=CRY1 PE=2 SV=1 7 549 2.0E-117
sp|O48652|UVR3_ARATH (6-4)DNA photolyase OS=Arabidopsis thaliana GN=UVR3 PE=1 SV=2 7 549 4.0E-110
sp|Q0E2Y1|UVR3_ORYSJ (6-4)DNA photolyase OS=Oryza sativa subsp. japonica GN=UVR3 PE=3 SV=1 7 549 2.0E-104
sp|Q17DK5|CRY1_AEDAE Cryptochrome-1 OS=Aedes aegypti GN=cry PE=3 SV=1 7 535 4.0E-77
sp|Q7PYI7|CRY1_ANOGA Cryptochrome-1 OS=Anopheles gambiae GN=Cry1 PE=2 SV=4 7 547 1.0E-73
sp|Q293P8|CRY1_DROPS Cryptochrome-1 OS=Drosophila pseudoobscura pseudoobscura GN=cry PE=3 SV=2 7 548 2.0E-68
sp|O77059|CRY1_DROME Cryptochrome-1 OS=Drosophila melanogaster GN=cry PE=1 SV=1 2 546 6.0E-68
sp|B0WRR9|CRY1_CULQU Cryptochrome-1 OS=Culex quinquefasciatus GN=cry PE=3 SV=1 240 536 1.0E-45
sp|P77967|CRYD_SYNY3 Cryptochrome DASH OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=cry PE=1 SV=2 4 553 1.0E-39
sp|P05327|PHR_SYNP6 Deoxyribodipyrimidine photo-lyase OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) GN=phr PE=1 SV=4 6 504 3.0E-39
sp|Q4KML2|CRYD_DANRE Cryptochrome DASH OS=Danio rerio GN=cry-dash PE=2 SV=2 6 532 4.0E-38
sp|P12768|PHR_STRGR Deoxyribodipyrimidine photo-lyase OS=Streptomyces griseus GN=phr PE=3 SV=1 7 539 7.0E-38
sp|A9CJC9|PHRA_AGRFC Deoxyribodipyrimidine photo-lyase OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=phrA PE=1 SV=1 6 544 4.0E-37
sp|Q75WS4|CRYD_XENLA Cryptochrome DASH OS=Xenopus laevis GN=cry-dash PE=2 SV=1 6 500 4.0E-36
sp|Q04449|PHR_BACPE Deoxyribodipyrimidine photo-lyase OS=Bacillus pseudofirmus (strain OF4) GN=phr PE=3 SV=2 9 546 1.0E-35
sp|Q55081|PHR_SYNY3 Deoxyribodipyrimidine photo-lyase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=phrA PE=1 SV=1 4 538 2.0E-34
sp|Q7NMD1|CRYD_GLOVI Cryptochrome DASH OS=Gloeobacter violaceus (strain PCC 7421) GN=cry PE=3 SV=1 1 536 6.0E-34
sp|Q7UJB1|CRYD_RHOBA Cryptochrome DASH OS=Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1) GN=cry PE=3 SV=2 7 534 4.0E-33
sp|P40115|CRY1_SINAL Cryptochrome-1 OS=Sinapis alba GN=PHR1 PE=2 SV=1 2 548 3.0E-32
sp|Q96524|CRY2_ARATH Cryptochrome-2 OS=Arabidopsis thaliana GN=CRY2 PE=1 SV=2 5 553 5.0E-32
sp|Q3IPX9|CRYD_NATPD Cryptochrome DASH OS=Natronomonas pharaonis (strain ATCC 35678 / DSM 2160) GN=cry PE=3 SV=1 7 537 1.0E-31
sp|Q38JU2|CRYD_SOLLC Cryptochrome DASH, chloroplastic/mitochondrial OS=Solanum lycopersicum GN=CRYD PE=2 SV=2 7 521 5.0E-31
sp|Q9HQ46|PHR_HALSA Deoxyribodipyrimidine photo-lyase OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=phr PE=3 SV=2 223 548 1.0E-30
sp|Q9KNA8|PHR_VIBCH Deoxyribodipyrimidine photo-lyase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=phrA PE=1 SV=1 275 548 2.0E-30
sp|Q5IFN2|CRYD_OSTTA Cryptochrome DASH, chloroplastic/mitochondrial OS=Ostreococcus tauri GN=Ot01g06470 PE=3 SV=1 1 512 1.0E-27
sp|Q651U1|CRYD_ORYSJ Cryptochrome DASH, chloroplastic/mitochondrial OS=Oryza sativa subsp. japonica GN=CRYD PE=2 SV=1 7 491 8.0E-27
sp|Q84KJ5|CRYD_ARATH Cryptochrome DASH, chloroplastic/mitochondrial OS=Arabidopsis thaliana GN=CRYD PE=1 SV=2 3 525 3.0E-26
sp|P57386|PHR_BUCAI Deoxyribodipyrimidine photo-lyase OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=phrB PE=3 SV=1 7 556 4.0E-26
sp|P00914|PHR_ECOLI Deoxyribodipyrimidine photo-lyase OS=Escherichia coli (strain K12) GN=phrB PE=1 SV=1 382 548 5.0E-26
sp|P25078|PHR_SALTY Deoxyribodipyrimidine photo-lyase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=phrB PE=1 SV=2 374 548 1.0E-25
sp|Q43125|CRY1_ARATH Cryptochrome-1 OS=Arabidopsis thaliana GN=CRY1 PE=1 SV=2 7 551 1.0E-24
sp|Q89AJ9|PHR_BUCBP Deoxyribodipyrimidine photo-lyase OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=phrB PE=3 SV=1 9 548 2.0E-24
sp|P27526|PHR_NEUCR Deoxyribodipyrimidine photo-lyase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=phr PE=3 SV=2 6 548 3.0E-20
sp|Q7SI68|CRYD_NEUCR Putative cryptochrome DASH, mitochondrial OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=cry PE=3 SV=1 234 512 8.0E-20
sp|Q5QXE0|CRYD_IDILO Cryptochrome DASH OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=cry PE=3 SV=1 7 488 1.0E-17
sp|Q4I1Q6|CRYD_GIBZE Putative cryptochrome DASH OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=FGSG_08852 PE=3 SV=1 6 535 1.0E-16
sp|Q9KS67|CRY2_VIBCH Cryptochrome-like protein cry2 OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=cry2 PE=1 SV=1 240 534 5.0E-16
sp|P61496|PHR_THET2 Deoxyribodipyrimidine photo-lyase OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=phr PE=1 SV=1 275 487 2.0E-15
sp|P61497|PHR_THET8 Deoxyribodipyrimidine photo-lyase OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=phr PE=1 SV=1 271 487 4.0E-15
sp|P05066|PHR_YEAST Deoxyribodipyrimidine photo-lyase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PHR1 PE=1 SV=1 379 488 8.0E-14
sp|Q9KR33|CRYD_VIBCH Cryptochrome DASH OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=cry1 PE=1 SV=1 379 485 2.0E-11
sp|Q87JP5|CRYD_VIBPA Cryptochrome DASH OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=cry PE=3 SV=1 379 484 4.0E-10
sp|Q8LB72|PHR2_ARATH Blue-light photoreceptor PHR2 OS=Arabidopsis thaliana GN=PHR2 PE=2 SV=2 9 295 7.0E-07
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 47 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|7302
MTKPRVIYWFRTDLRLHDSPALKAALDLQPAVLWPIFTWDPHYVYGKKAGLNRWQFLLDCQNDLSRSITKLNPKS
KLFVLREAPQTLLPKLFRAWRVTHLVFEKDTDAYARERDAAVAEAAKEAGVELVVRSGRTLWDSDALVDKHGGKP
TMSMAQLRAAGAKLGPVPRPLPAPDRLPDPGDMPLDFEHGPPPDAEPDLNADRRVDGVSSYRSVAGPKGDFAIET
MHELGFPPATTPHRGGETVALKRLDDVVSDADYAATFEKPKTSPAQFEPQSTTLLSPFLHFGALSVREFYWRVQD
VVDAYGKGASAPPASLTGQLLFRDMYFAAQAALGPVFTQTARNPHCRFVPWHLPSKRDAATGLVTGDYHVDSDEA
ETWFSRWKAGLTGFPWIDALMRQLREEGWIHHLGRHSLACFLTRGGCYVDWERGADVFEELLLDHEPACNAGNWQ
WLSCTAFFAQYFRCYSPVSFGQKWDKKGDFIRRWVPELKHLDAKFIYEPWKAPIQDQKKAGVRVTGDGLSASAEG
TYPKPMFDFSQRRSVCIGAMKKAYDVGLHGNDERVLDGSWRELFPSPGEAEVQGEFESDDGQKADDADHEDAEPA
AGAKRHARKASSEAASKKQKK*
Coding >Hirsu2|7302
ATGACCAAGCCCCGCGTCATCTACTGGTTCCGGACCGACCTGCGCCTCCACGACTCGCCCGCCCTCAAGGCTGCC
CTCGACCTGCAGCCTGCCGTCCTCTGGCCCATCTTCACCTGGGACCCTCACTATGTGTATGGGAAGAAGGCCGGC
CTGAACCGATGGCAGTTCCTGCTGGACTGCCAGAATGACCTCTCCCGCTCCATCACCAAGCTCAACCCCAAGTCC
AAGCTGTTCGTCCTGCGCGAGGCGCCCCAGACGCTGCTCCCCAAGCTCTTCCGCGCCTGGCGCGTCACCCATCTC
GTCTTCGAGAAGGACACCGACGCCTACGCCCGCGAGCGCGATGCCGCCGTGGCCGAGGCCGCCAAGGAGGCCGGC
GTCGAGCTCGTCGTCCGCTCCGGCAGGACCCTCTGGGACAGCGACGCCCTCGTCGACAAGCACGGCGGCAAGCCC
ACCATGTCCATGGCCCAGCTCCGGGCCGCCGGCGCCAAGCTCGGCCCCGTCCCCCGGCCCCTGCCGGCCCCCGAC
CGCCTGCCGGACCCGGGCGACATGCCGCTCGACTTCGAGCACGGCCCGCCGCCCGACGCCGAGCCCGACCTCAAC
GCGGACCGCAGGGTCGACGGCGTCTCGTCCTACCGCAGCGTCGCCGGTCCGAAAGGCGACTTCGCCATCGAGACC
ATGCACGAGCTGGGCTTCCCGCCCGCCACCACGCCCCATCGCGGCGGCGAGACCGTCGCCCTGAAGCGGCTCGAC
GACGTCGTCAGCGACGCCGACTATGCCGCCACCTTTGAGAAGCCCAAGACCAGCCCGGCCCAGTTCGAGCCTCAG
TCCACCACCCTGCTGTCCCCGTTCCTCCACTTCGGCGCGCTGTCGGTCCGCGAGTTCTACTGGAGGGTCCAGGAC
GTCGTCGACGCGTACGGCAAGGGCGCGTCGGCGCCGCCCGCCAGCCTCACCGGCCAGCTGCTCTTCCGCGACATG
TACTTCGCCGCCCAGGCCGCCCTCGGCCCCGTCTTCACCCAGACGGCCCGGAACCCTCACTGCCGCTTCGTGCCC
TGGCACCTGCCGTCCAAGCGGGACGCCGCCACCGGCCTCGTCACCGGCGACTACCACGTCGACTCGGACGAGGCC
GAGACCTGGTTCAGCAGGTGGAAGGCCGGCCTCACCGGCTTCCCCTGGATCGACGCCCTCATGCGCCAGCTGCGC
GAGGAGGGCTGGATCCATCACCTCGGCCGCCACTCCCTGGCCTGCTTCCTCACCAGGGGCGGCTGCTACGTCGAC
TGGGAGCGCGGCGCCGACGTCTTCGAGGAGCTGCTCCTCGACCACGAGCCCGCCTGCAACGCCGGCAACTGGCAG
TGGCTCTCCTGCACCGCCTTCTTCGCCCAGTACTTCCGCTGCTACAGCCCCGTCTCCTTCGGCCAGAAATGGGAC
AAGAAGGGCGACTTCATCCGCCGCTGGGTGCCGGAGCTCAAGCACCTCGACGCCAAGTTCATCTATGAGCCGTGG
AAGGCCCCCATCCAGGACCAGAAGAAGGCGGGCGTGCGCGTGACCGGCGACGGCCTGTCGGCCAGCGCCGAGGGG
ACCTATCCGAAGCCCATGTTCGACTTCTCGCAGCGCCGCAGCGTCTGCATCGGGGCCATGAAGAAGGCCTACGAC
GTCGGCCTGCACGGAAACGACGAGCGCGTCCTCGACGGGAGCTGGCGGGAGCTGTTCCCGTCGCCCGGCGAGGCC
GAGGTGCAGGGTGAGTTTGAGAGCGATGATGGCCAGAAGGCGGATGACGCGGACCACGAGGACGCAGAGCCGGCG
GCGGGGGCCAAGCGACATGCCAGGAAAGCCAGTTCCGAGGCGGCGTCCAAGAAGCAGAAGAAATAG
Transcript >Hirsu2|7302
ATGACCAAGCCCCGCGTCATCTACTGGTTCCGGACCGACCTGCGCCTCCACGACTCGCCCGCCCTCAAGGCTGCC
CTCGACCTGCAGCCTGCCGTCCTCTGGCCCATCTTCACCTGGGACCCTCACTATGTGTATGGGAAGAAGGCCGGC
CTGAACCGATGGCAGTTCCTGCTGGACTGCCAGAATGACCTCTCCCGCTCCATCACCAAGCTCAACCCCAAGTCC
AAGCTGTTCGTCCTGCGCGAGGCGCCCCAGACGCTGCTCCCCAAGCTCTTCCGCGCCTGGCGCGTCACCCATCTC
GTCTTCGAGAAGGACACCGACGCCTACGCCCGCGAGCGCGATGCCGCCGTGGCCGAGGCCGCCAAGGAGGCCGGC
GTCGAGCTCGTCGTCCGCTCCGGCAGGACCCTCTGGGACAGCGACGCCCTCGTCGACAAGCACGGCGGCAAGCCC
ACCATGTCCATGGCCCAGCTCCGGGCCGCCGGCGCCAAGCTCGGCCCCGTCCCCCGGCCCCTGCCGGCCCCCGAC
CGCCTGCCGGACCCGGGCGACATGCCGCTCGACTTCGAGCACGGCCCGCCGCCCGACGCCGAGCCCGACCTCAAC
GCGGACCGCAGGGTCGACGGCGTCTCGTCCTACCGCAGCGTCGCCGGTCCGAAAGGCGACTTCGCCATCGAGACC
ATGCACGAGCTGGGCTTCCCGCCCGCCACCACGCCCCATCGCGGCGGCGAGACCGTCGCCCTGAAGCGGCTCGAC
GACGTCGTCAGCGACGCCGACTATGCCGCCACCTTTGAGAAGCCCAAGACCAGCCCGGCCCAGTTCGAGCCTCAG
TCCACCACCCTGCTGTCCCCGTTCCTCCACTTCGGCGCGCTGTCGGTCCGCGAGTTCTACTGGAGGGTCCAGGAC
GTCGTCGACGCGTACGGCAAGGGCGCGTCGGCGCCGCCCGCCAGCCTCACCGGCCAGCTGCTCTTCCGCGACATG
TACTTCGCCGCCCAGGCCGCCCTCGGCCCCGTCTTCACCCAGACGGCCCGGAACCCTCACTGCCGCTTCGTGCCC
TGGCACCTGCCGTCCAAGCGGGACGCCGCCACCGGCCTCGTCACCGGCGACTACCACGTCGACTCGGACGAGGCC
GAGACCTGGTTCAGCAGGTGGAAGGCCGGCCTCACCGGCTTCCCCTGGATCGACGCCCTCATGCGCCAGCTGCGC
GAGGAGGGCTGGATCCATCACCTCGGCCGCCACTCCCTGGCCTGCTTCCTCACCAGGGGCGGCTGCTACGTCGAC
TGGGAGCGCGGCGCCGACGTCTTCGAGGAGCTGCTCCTCGACCACGAGCCCGCCTGCAACGCCGGCAACTGGCAG
TGGCTCTCCTGCACCGCCTTCTTCGCCCAGTACTTCCGCTGCTACAGCCCCGTCTCCTTCGGCCAGAAATGGGAC
AAGAAGGGCGACTTCATCCGCCGCTGGGTGCCGGAGCTCAAGCACCTCGACGCCAAGTTCATCTATGAGCCGTGG
AAGGCCCCCATCCAGGACCAGAAGAAGGCGGGCGTGCGCGTGACCGGCGACGGCCTGTCGGCCAGCGCCGAGGGG
ACCTATCCGAAGCCCATGTTCGACTTCTCGCAGCGCCGCAGCGTCTGCATCGGGGCCATGAAGAAGGCCTACGAC
GTCGGCCTGCACGGAAACGACGAGCGCGTCCTCGACGGGAGCTGGCGGGAGCTGTTCCCGTCGCCCGGCGAGGCC
GAGGTGCAGGGTGAGTTTGAGAGCGATGATGGCCAGAAGGCGGATGACGCGGACCACGAGGACGCAGAGCCGGCG
GCGGGGGCCAAGCGACATGCCAGGAAAGCCAGTTCCGAGGCGGCGTCCAAGAAGCAGAAGAAATAG
Gene >Hirsu2|7302
ATGACCAAGCCCCGCGTCATCTACTGGTTCCGGACCGACCTGCGCCTCCACGACTCGCCCGCCCTCAAGGCTGCC
CTCGACCTGCAGCCTGCCGTCCTCTGGCCCATCTTCACCTGGGACCCTCACTATGTGTATGGGAAGAAGGCCGGC
CTGAACCGATGGCAGTTCCTGTAAGCCCCCTCCTCCCGACAGGGAGAGTAGAGCGGCGCCTCCCGACAGGGAGAC
CAGAGCGGCGCAGGCTGTGTGTGTGTGCTGGTCCCGTCGCCCCAGCTGACGGCGCGCCGGCAGGCTGGACTGCCA
GAATGACCTCTCCCGCTCCATCACCAAGCTCAACCCCAAGTCCAAGCTGTTCGTCCTGCGCGAGGCGCCCCAGAC
GCTGCTCCCCAAGCTCTTCCGCGCCTGGCGCGTCACCCATCTCGTCTTCGAGAAGGACACCGACGCCTACGCCCG
CGAGCGCGATGCCGCCGTGGCCGAGGCCGCCAAGGAGGCCGGCGTCGAGCTCGTCGTCCGCTCCGGCAGGACCCT
CTGGGACAGCGACGCCCTCGTCGACAAGCACGGCGGCAAGCCCACCATGTCCATGGCCCAGCTCCGGGCCGCCGG
CGCCAAGCTCGGCCCCGTCCCCCGGCCCCTGCCGGCCCCCGACCGCCTGCCGGACCCGGGCGACATGCCGCTCGA
CTTCGAGCACGGCCCGCCGCCCGACGCCGAGCCCGACCTCAACGCGGACCGCAGGGTCGACGGCGTCTCGTCCTA
CCGCAGCGTCGCCGGTCCGAAAGGCGACTTCGCCATCGAGACCATGCACGAGCTGGGCTTCCCGCCCGCCACCAC
GCCCCATCGCGGCGGCGAGACCGTCGCCCTGAAGCGGCTCGACGACGTCGTCAGCGACGCCGACTATGCCGCCAC
CTTTGAGAAGCCCAAGACCAGCCCGGCCCAGTTCGAGCCTCAGTCCACCACCCTGCTGTCCCCGTTCCTCCACTT
CGGCGCGCTGTCGGTCCGCGAGTTCTACTGGAGGGTCCAGGACGTCGTCGACGCGTACGGCAAGGGCGCGTCGGC
GCCGCCCGCCAGCCTCACCGGCCAGCTGCTCTTCCGCGACATGTACTTCGCCGCCCAGGCCGCCCTCGGCCCCGT
CTTCACCCAGACGGCCCGGAACCCTCACTGCCGCTTCGTGCCCTGGCACCTGCCGTCCAAGCGGGACGCCGCCAC
CGGCCTCGTCACCGGCGACTACCACGTCGACTCGGACGAGGCCGAGACCTGGTTCAGCAGGTGGAAGGCCGGCCT
CACCGGCTTCCCCTGGATCGACGCCCTCATGCGCCAGCTGCGCGAGGAGGGCTGGATCCATCACCTCGGCCGCCA
CTCCCTGGCCTGCTTCCTCACCAGGGGCGGCTGCTACGTCGACTGGGAGCGCGGCGCCGACGTCTTCGAGGAGCT
GCTCCTCGACCACGAGCCCGCCTGCAACGCCGGCAACTGGCAGTGGCTCTCCTGCACCGCCTTCTTCGCCCAGTA
CTTCCGCTGCTACAGCCCCGTCTCCTTCGGCCAGAAATGGGACAAGAAGGGCGACTTCATCCGCCGCTGGGTGCC
GGAGCTCAAGCACCTCGACGCCAAGTTCATCTATGAGCCGTGGAAGGCCCCCATCCAGGACCAGAAGAAGGCGGG
CGTGCGCGTGACCGGCGACGGCCTGTCGGCCAGCGCCGAGGGGACCTATCCGAAGCCCATGTTCGACTTCTCGCA
GCGCCGCAGCGTCTGCATCGGGGCCATGAAGAAGGCCTACGACGTCGGCCTGCACGGAAACGACGAGCGCGTCCT
CGACGGGAGCTGGCGGGAGCTGTTCCCGTCGCCCGGCGAGGCCGAGGTGCAGGGTGAGTTTGAGAGCGATGATGG
CCAGAAGGCGGATGACGCGGACCACGAGGACGCAGAGCCGGCGGCGGGGGCCAAGCGACATGCCAGGAAAGCCAG
TTCCGAGGCGGCGTCCAAGAAGCAGAAGAAATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail