Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|7296
Gene name
LocationContig_415:15261..16029
Strand+
Gene length (bp)768
Transcript length (bp)456
Coding sequence length (bp)456
Protein length (aa) 152

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08069 Ribosomal_S13_N Ribosomal S13/S15 N-terminal domain 6.0E-30 1 60
PF00312 Ribosomal_S15 Ribosomal protein S15 2.1E-15 74 146

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P33192|RS13_CANMA 40S ribosomal protein S13 OS=Candida maltosa GN=RPS13 PE=3 SV=2 1 151 3.0E-89
sp|P05756|RS13_YEAST 40S ribosomal protein S13 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPS13 PE=1 SV=3 1 150 1.0E-85
sp|P59223|RS131_ARATH 40S ribosomal protein S13-1 OS=Arabidopsis thaliana GN=RPS13A PE=2 SV=1 1 151 1.0E-85
sp|P59224|RS132_ARATH 40S ribosomal protein S13-2 OS=Arabidopsis thaliana GN=RPS13B PE=2 SV=1 1 151 2.0E-84
sp|P28189|RS13_SCHPO 40S ribosomal protein S13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rps13 PE=1 SV=2 1 151 2.0E-84
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P33192|RS13_CANMA 40S ribosomal protein S13 OS=Candida maltosa GN=RPS13 PE=3 SV=2 1 151 3.0E-89
sp|P05756|RS13_YEAST 40S ribosomal protein S13 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPS13 PE=1 SV=3 1 150 1.0E-85
sp|P59223|RS131_ARATH 40S ribosomal protein S13-1 OS=Arabidopsis thaliana GN=RPS13A PE=2 SV=1 1 151 1.0E-85
sp|P59224|RS132_ARATH 40S ribosomal protein S13-2 OS=Arabidopsis thaliana GN=RPS13B PE=2 SV=1 1 151 2.0E-84
sp|P28189|RS13_SCHPO 40S ribosomal protein S13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rps13 PE=1 SV=2 1 151 2.0E-84
sp|P49393|RS13_XENLA 40S ribosomal protein S13 OS=Xenopus laevis GN=rps13 PE=3 SV=2 1 151 8.0E-84
sp|P62278|RS13_RAT 40S ribosomal protein S13 OS=Rattus norvegicus GN=Rps13 PE=1 SV=2 1 151 8.0E-84
sp|P62301|RS13_MOUSE 40S ribosomal protein S13 OS=Mus musculus GN=Rps13 PE=1 SV=2 1 151 8.0E-84
sp|P62277|RS13_HUMAN 40S ribosomal protein S13 OS=Homo sapiens GN=RPS13 PE=1 SV=2 1 151 8.0E-84
sp|Q6ITC7|RS13_CHICK 40S ribosomal protein S13 OS=Gallus gallus GN=RPS13 PE=2 SV=3 1 151 8.0E-84
sp|Q56JX8|RS13_BOVIN 40S ribosomal protein S13 OS=Bos taurus GN=RPS13 PE=2 SV=3 1 151 8.0E-84
sp|P62302|RS13_SOYBN 40S ribosomal protein S13 OS=Glycine max GN=RPS13 PE=2 SV=1 1 151 2.0E-83
sp|Q9WVH0|RS13_CRIGR 40S ribosomal protein S13 OS=Cricetulus griseus GN=RPS13 PE=3 SV=3 1 151 5.0E-83
sp|P47772|RS13_ICTPU 40S ribosomal protein S13 OS=Ictalurus punctatus GN=rps13 PE=2 SV=3 1 151 2.0E-82
sp|P78571|RS13_AGABI 40S ribosomal protein S13 OS=Agaricus bisporus GN=RPS13 PE=2 SV=1 1 151 3.0E-82
sp|P46298|RS13_PEA 40S ribosomal protein S13 OS=Pisum sativum GN=RPS13 PE=2 SV=1 1 151 4.0E-82
sp|Q9DFR6|RS13_GILMI 40S ribosomal protein S13 OS=Gillichthys mirabilis GN=rps13 PE=2 SV=3 1 151 6.0E-82
sp|Q962R6|RS13_SPOFR 40S ribosomal protein S13 OS=Spodoptera frugiperda GN=RpS13 PE=2 SV=3 1 151 1.0E-81
sp|O77303|RS13_LUMRU 40S ribosomal protein S13 OS=Lumbricus rubellus GN=RPS13 PE=2 SV=3 1 151 1.0E-81
sp|Q8I7D6|RS13_CIOIN 40S ribosomal protein S13 OS=Ciona intestinalis GN=RPS13 PE=2 SV=3 1 151 4.0E-81
sp|Q8I7U0|RS13_PLUXY 40S ribosomal protein S13 OS=Plutella xylostella GN=RpS13 PE=2 SV=3 1 151 2.0E-80
sp|Q8MUR2|RS13_CHOPR 40S ribosomal protein S13 OS=Choristoneura parallela GN=RpS13 PE=2 SV=3 1 151 3.0E-80
sp|Q69UI1|RS132_ORYSJ 40S ribosomal protein S13-2 OS=Oryza sativa subsp. japonica GN=Os08g0117300 PE=1 SV=1 1 151 4.0E-80
sp|Q69UI2|RS131_ORYSJ 40S ribosomal protein S13-1 OS=Oryza sativa subsp. japonica GN=Os08g0117200 PE=3 SV=2 1 151 7.0E-80
sp|Q05761|RS13_MAIZE 40S ribosomal protein S13 OS=Zea mays GN=RPS13 PE=2 SV=1 1 151 1.0E-79
sp|P62300|RS13_WUCBA 40S ribosomal protein S13 OS=Wuchereria bancrofti GN=RPS13 PE=3 SV=2 1 151 6.0E-79
sp|P62299|RS13_BRUPA 40S ribosomal protein S13 OS=Brugia pahangi GN=RPS13 PE=2 SV=2 1 151 6.0E-79
sp|P52811|RS13_ANOGA 40S ribosomal protein S13 OS=Anopheles gambiae GN=RpS13 PE=2 SV=2 1 151 4.0E-78
sp|Q03334|RS13_DROME 40S ribosomal protein S13 OS=Drosophila melanogaster GN=RpS13 PE=1 SV=3 1 151 5.0E-78
sp|P51404|RS13_CAEEL 40S ribosomal protein S13 OS=Caenorhabditis elegans GN=rps-13 PE=3 SV=2 1 151 3.0E-75
sp|Q54PH8|RS13_DICDI 40S ribosomal protein S13 OS=Dictyostelium discoideum GN=rps13 PE=3 SV=1 1 151 1.0E-66
sp|P27072|RS13_MUSDO 40S ribosomal protein S13 (Fragment) OS=Musca domestica GN=RpS13 PE=2 SV=1 39 151 3.0E-60
sp|P62279|RS13_PIG 40S ribosomal protein S13 (Fragment) OS=Sus scrofa GN=RPS13 PE=2 SV=2 1 107 2.0E-54
sp|A1RXJ1|RS15_THEPD 30S ribosomal protein S15 OS=Thermofilum pendens (strain Hrk 5) GN=rps15 PE=3 SV=1 6 144 3.0E-46
sp|Q8TV08|RS15_METKA 30S ribosomal protein S15 OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=rps15 PE=3 SV=1 1 142 7.0E-46
sp|P54012|RS15_METJA 30S ribosomal protein S15 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=rps15 PE=3 SV=2 1 150 1.0E-45
sp|Q5JGJ4|RS15_THEKO 30S ribosomal protein S15 OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=rps15 PE=3 SV=1 1 150 8.0E-45
sp|A6UUL9|RS15_META3 30S ribosomal protein S15 OS=Methanococcus aeolicus (strain Nankai-3 / ATCC BAA-1280) GN=rps15 PE=3 SV=1 1 150 4.0E-42
sp|Q2FS30|RS15_METHJ 30S ribosomal protein S15 OS=Methanospirillum hungatei JF-1 (strain ATCC 27890 / DSM 864 / NBRC 100397 / JF-1) GN=rps15 PE=3 SV=1 1 151 5.0E-41
sp|Q9YCX3|RS15_AERPE 30S ribosomal protein S15 OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=rps15 PE=3 SV=1 9 151 2.0E-40
sp|Q0W938|RS15_METAR 30S ribosomal protein S15 OS=Methanocella arvoryzae (strain DSM 22066 / NBRC 105507 / MRE50) GN=rps15 PE=3 SV=1 1 151 2.0E-40
sp|O29457|RS15_ARCFU 30S ribosomal protein S15 OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=rps15 PE=3 SV=1 1 141 3.0E-40
sp|A8MCD3|RS15_CALMQ 30S ribosomal protein S15 OS=Caldivirga maquilingensis (strain ATCC 700844 / DSM 13496 / JCM 10307 / IC-167) GN=rps15 PE=3 SV=1 9 141 4.0E-40
sp|Q8ZT11|RS15_PYRAE 30S ribosomal protein S15 OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=rps15 PE=3 SV=1 9 149 2.0E-39
sp|A6UQM4|RS15_METVS 30S ribosomal protein S15 OS=Methanococcus vannielii (strain SB / ATCC 35089 / DSM 1224) GN=rps15 PE=3 SV=1 1 150 3.0E-39
sp|A8AAU0|RS15_IGNH4 30S ribosomal protein S15 OS=Ignicoccus hospitalis (strain KIN4/I / DSM 18386 / JCM 14125) GN=rps15 PE=3 SV=1 7 150 3.0E-39
sp|Q8PVA5|RS15_METMA 30S ribosomal protein S15 OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=rps15 PE=3 SV=1 1 151 7.0E-39
sp|A3DMT2|RS15_STAMF 30S ribosomal protein S15 OS=Staphylothermus marinus (strain ATCC 43588 / DSM 3639 / JCM 9404 / F1) GN=rps15 PE=3 SV=1 7 151 1.0E-38
sp|A1RSM4|RS15_PYRIL 30S ribosomal protein S15 OS=Pyrobaculum islandicum (strain DSM 4184 / JCM 9189 / GEO3) GN=rps15 PE=3 SV=1 9 149 5.0E-38
sp|A3MVD1|RS15_PYRCJ 30S ribosomal protein S15 OS=Pyrobaculum calidifontis (strain JCM 11548 / VA1) GN=rps15 PE=3 SV=1 9 149 5.0E-38
sp|A4WMA2|RS15_PYRAR 30S ribosomal protein S15 OS=Pyrobaculum arsenaticum (strain DSM 13514 / JCM 11321) GN=rps15 PE=3 SV=1 9 149 8.0E-38
sp|A9A4V0|RS15_NITMS 30S ribosomal protein S15 OS=Nitrosopumilus maritimus (strain SCM1) GN=rps15 PE=3 SV=1 1 147 9.0E-38
sp|Q8TS56|RS15_METAC 30S ribosomal protein S15 OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=rps15 PE=3 SV=1 1 151 1.0E-37
sp|Q8TZD9|RS15_PYRFU 30S ribosomal protein S15 OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=rps15 PE=1 SV=1 1 150 2.0E-37
sp|Q2NIA9|RS15_METST 30S ribosomal protein S15 OS=Methanosphaera stadtmanae (strain ATCC 43021 / DSM 3091 / JCM 11832 / MCB-3) GN=rps15 PE=3 SV=1 21 150 4.0E-37
sp|Q9V2K9|RS15_PYRAB 30S ribosomal protein S15 OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=rps15 PE=3 SV=1 1 150 4.0E-37
sp|Q12TM7|RS15_METBU 30S ribosomal protein S15 OS=Methanococcoides burtonii (strain DSM 6242 / NBRC 107633 / OCM 468 / ACE-M) GN=rps15 PE=3 SV=1 1 151 1.0E-36
sp|A4G0Z3|RS15_METM5 30S ribosomal protein S15 OS=Methanococcus maripaludis (strain C5 / ATCC BAA-1333) GN=rps15 PE=3 SV=1 1 150 2.0E-36
sp|O57805|RS15_PYRHO 30S ribosomal protein S15 OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=rps15 PE=3 SV=1 1 150 2.0E-36
sp|A2BJY6|RS15_HYPBU 30S ribosomal protein S15 OS=Hyperthermus butylicus (strain DSM 5456 / JCM 9403 / PLM1-5) GN=rps15 PE=3 SV=1 9 151 3.0E-36
sp|Q6LWX5|RS15_METMP 30S ribosomal protein S15 OS=Methanococcus maripaludis (strain S2 / LL) GN=rps15 PE=3 SV=1 1 150 4.0E-36
sp|A6VHG7|RS15_METM7 30S ribosomal protein S15 OS=Methanococcus maripaludis (strain C7 / ATCC BAA-1331) GN=rps15 PE=3 SV=1 1 150 4.0E-36
sp|A2SQ60|RS15_METLZ 30S ribosomal protein S15 OS=Methanocorpusculum labreanum (strain ATCC 43576 / DSM 4855 / Z) GN=rps15 PE=3 SV=1 1 151 5.0E-36
sp|Q46BC9|RS15_METBF 30S ribosomal protein S15 OS=Methanosarcina barkeri (strain Fusaro / DSM 804) GN=rps15 PE=3 SV=1 1 151 1.0E-35
sp|A0RTT1|RS15_CENSY 30S ribosomal protein S15 OS=Cenarchaeum symbiosum (strain A) GN=rps15 PE=3 SV=1 1 146 1.0E-35
sp|Q980A8|RS15_SULSO 30S ribosomal protein S15 OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=rps15 PE=3 SV=1 7 151 2.0E-35
sp|Q8SRB3|RS13_ENCCU 40S ribosomal protein S13 OS=Encephalitozoon cuniculi (strain GB-M1) GN=RPS13 PE=1 SV=1 1 140 3.0E-35
sp|Q975N5|RS15_SULTO 30S ribosomal protein S15 OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=rps15 PE=3 SV=1 10 151 3.0E-35
sp|A4YIY3|RS15_METS5 30S ribosomal protein S15 OS=Metallosphaera sedula (strain ATCC 51363 / DSM 5348) GN=rps15 PE=3 SV=1 7 151 1.0E-34
sp|A3CSL3|RS15_METMJ 30S ribosomal protein S15 OS=Methanoculleus marisnigri (strain ATCC 35101 / DSM 1498 / JR1) GN=rps15 PE=3 SV=1 1 150 3.0E-34
sp|A5UMH1|RS15_METS3 30S ribosomal protein S15 OS=Methanobrevibacter smithii (strain PS / ATCC 35061 / DSM 861) GN=rps15 PE=3 SV=1 21 150 5.0E-34
sp|O27474|RS15_METTH 30S ribosomal protein S15 OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=rps15 PE=3 SV=1 23 150 9.0E-34
sp|Q4JAI3|RS15_SULAC 30S ribosomal protein S15 OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=rps15 PE=3 SV=1 7 150 4.0E-32
sp|Q74MB8|RS15_NANEQ 30S ribosomal protein S15 OS=Nanoarchaeum equitans (strain Kin4-M) GN=rps15 PE=3 SV=1 1 146 1.0E-31
sp|A7IAI8|RS15_METB6 30S ribosomal protein S15 OS=Methanoregula boonei (strain 6A8) GN=rps15 PE=3 SV=1 1 151 5.0E-29
sp|Q3IQA3|RS15_NATPD 30S ribosomal protein S15 OS=Natronomonas pharaonis (strain ATCC 35678 / DSM 2160) GN=rps15 PE=3 SV=1 1 144 5.0E-28
sp|Q9HRA2|RS15_HALSA 30S ribosomal protein S15 OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=rps15 PE=3 SV=1 1 150 6.0E-28
sp|Q9HJ42|RS15_THEAC 30S ribosomal protein S15 OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=rps15 PE=3 SV=1 1 139 5.0E-27
sp|Q18HQ4|RS15_HALWD 30S ribosomal protein S15 OS=Haloquadratum walsbyi (strain DSM 16790 / HBSQ001) GN=rps15 PE=3 SV=1 1 130 2.0E-26
sp|Q6L2H3|RS15_PICTO 30S ribosomal protein S15 OS=Picrophilus torridus (strain ATCC 700027 / DSM 9790 / JCM 10055 / NBRC 100828) GN=rps15 PE=3 SV=1 1 142 2.0E-25
sp|Q979D0|RS15_THEVO 30S ribosomal protein S15 OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=rps15 PE=3 SV=1 1 139 3.0E-25
sp|P05762|RS15_HALMA 30S ribosomal protein S15 OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=rps15 PE=1 SV=3 1 144 6.0E-25
sp|A0B5E6|RS15_METTP 30S ribosomal protein S15 OS=Methanosaeta thermophila (strain DSM 6194 / JCM 14653 / NBRC 101360 / PT) GN=rps15 PE=3 SV=1 1 151 9.0E-25
[Show less]

GO

GO Term Description Terminal node
GO:0003735 structural constituent of ribosome Yes
GO:0005622 intracellular Yes
GO:0005840 ribosome Yes
GO:0006412 translation Yes
GO:0008152 metabolic process No
GO:1990904 ribonucleoprotein complex No
GO:0044237 cellular metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0043604 amide biosynthetic process No
GO:0071704 organic substance metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0044238 primary metabolic process No
GO:0043232 intracellular non-membrane-bounded organelle No
GO:0044267 cellular protein metabolic process No
GO:0043229 intracellular organelle No
GO:0008150 biological_process No
GO:0044260 cellular macromolecule metabolic process No
GO:0043603 cellular amide metabolic process No
GO:0043226 organelle No
GO:0003674 molecular_function No
GO:0005575 cellular_component No
GO:0019538 protein metabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0032991 protein-containing complex No
GO:0044424 intracellular part No
GO:0005198 structural molecule activity No
GO:0034645 cellular macromolecule biosynthetic process No
GO:0009059 macromolecule biosynthetic process No
GO:0044249 cellular biosynthetic process No
GO:0044271 cellular nitrogen compound biosynthetic process No
GO:0009058 biosynthetic process No
GO:0009987 cellular process No
GO:0044444 cytoplasmic part No
GO:0044464 cell part No
GO:1901566 organonitrogen compound biosynthetic process No
GO:1901576 organic substance biosynthetic process No
GO:0043228 non-membrane-bounded organelle No
GO:0043043 peptide biosynthetic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0006518 peptide metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 22 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|7296
MGRLHSKGKGISASAIPYSRAPPTWLKTTPEQVVEQICKLARKGATPSQIGVILRDSHGIAQVKIVTGNKILRIL
KSNGLAPELPEDLYMLIKKAVAVRKHLERNRKDKDSKFRLILIESRIHRLARYYKTVGVLPPTWKYESATASTIV
A*
Coding >Hirsu2|7296
ATGGGTAGACTTCACAGCAAGGGCAAGGGCATTTCCGCCTCTGCGATCCCCTATTCGCGCGCTCCTCCGACGTGG
CTCAAGACGACTCCCGAGCAGGTCGTCGAGCAGATCTGCAAGCTGGCCAGGAAGGGTGCCACGCCGTCGCAGATT
GGCGTCATCCTGCGAGACTCGCACGGCATTGCGCAGGTCAAGATCGTCACCGGCAACAAGATTCTGCGAATCCTC
AAATCGAACGGCCTCGCTCCCGAGCTTCCTGAGGATCTGTACATGTTGATCAAGAAGGCCGTCGCCGTCCGCAAG
CACCTCGAGCGCAACCGCAAGGACAAGGACTCCAAGTTCCGCCTCATTCTCATCGAGTCCCGTATCCACCGTTTG
GCCCGCTACTACAAGACGGTCGGCGTGCTGCCTCCTACCTGGAAGTACGAGTCAGCCACCGCCAGCACCATTGTC
GCATAA
Transcript >Hirsu2|7296
ATGGGTAGACTTCACAGCAAGGGCAAGGGCATTTCCGCCTCTGCGATCCCCTATTCGCGCGCTCCTCCGACGTGG
CTCAAGACGACTCCCGAGCAGGTCGTCGAGCAGATCTGCAAGCTGGCCAGGAAGGGTGCCACGCCGTCGCAGATT
GGCGTCATCCTGCGAGACTCGCACGGCATTGCGCAGGTCAAGATCGTCACCGGCAACAAGATTCTGCGAATCCTC
AAATCGAACGGCCTCGCTCCCGAGCTTCCTGAGGATCTGTACATGTTGATCAAGAAGGCCGTCGCCGTCCGCAAG
CACCTCGAGCGCAACCGCAAGGACAAGGACTCCAAGTTCCGCCTCATTCTCATCGAGTCCCGTATCCACCGTTTG
GCCCGCTACTACAAGACGGTCGGCGTGCTGCCTCCTACCTGGAAGTACGAGTCAGCCACCGCCAGCACCATTGTC
GCATAA
Gene >Hirsu2|7296
ATGGGTAGACTTCACAGCAAGGGCAAGGGCATTTCCGCCTCTGCGATCCCCTATTCGCGCGCTCCTCCGACGTGG
CTCAAGACGACTCCCGAGCAGGTCGTCGAGCAGATCTGCAAGCTGGCCAGGAAGGGTGCCACGCCGTCGCAGATT
GGCGTCATCCTGCGAGACTCGCACGGCATTGCGCAGGTCAAGATCGTCACCGGTTCGTCTGCCCATTTTATGAGG
CGCAGGCCCTGAAGCGGGCGAGCCTGGAGGAAGGAGCATGAGGCTGGACGCGAAGCTGACTCGAAGGCAGGCAAC
AAGATTCTGCGAATCCTCAAATCGAACGGTAGAGCTCCCTGAAGCAAGAAAAACGAGAGACGGGTTATATGAAAA
AAAAAAAGCGCGCGATGCTTCGTGCCATCATCTCTCCAGGAGACGTTTCTTCTGTGCCTCTGTACGGTCACGGCT
GACAGAGAGATTCAACCAGGCCTCGCTCCCGAGCTTCCTGAGGATCTGTACATGTTGATCAAGAAGGTAGGAATC
TGCTCCAGGGGGGACAAGTGTACCCCTCACCCAGGCTGGCGTGCTGCTCTTCTGACCCGAGTGTCCTAGGCCGTC
GCCGTCCGCAAGCACCTCGAGCGCAACCGCAAGGACAAGGACTCCAAGTTCCGCCTCATTCTCATCGAGTCCCGT
ATCCACCGTTTGGCCCGCTACTACAAGACGGTCGGCGTGCTGCCTCCTACCTGGAAGTACGAGTCAGCCACCGCC
AGCACCATTGTCGCATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail