Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|7290
Gene name
LocationContig_414:16664..19440
Strand+
Gene length (bp)2776
Transcript length (bp)2514
Coding sequence length (bp)2514
Protein length (aa) 838

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00654 Voltage_CLC Voltage gated chloride channel 2.4E-88 185 566
PF00571 CBS CBS domain 4.2E-05 598 651
PF00571 CBS CBS domain 1.2E-05 708 753

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P0C197|CLCNX_USTMA Probable chloride channel protein UM03490-D OS=Ustilago maydis (strain 521 / FGSC 9021) GN=UMAG_11084 PE=3 SV=1 161 676 0.0E+00
sp|O60159|YHYB_SCHPO Putative anion/proton exchange transporter C19C7.11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC19C7.11 PE=3 SV=2 28 767 0.0E+00
sp|P51792|CLCN3_RAT H(+)/Cl(-) exchange transporter 3 OS=Rattus norvegicus GN=Clcn3 PE=2 SV=2 49 753 3.0E-176
sp|Q9R279|CLCN3_CAVPO H(+)/Cl(-) exchange transporter 3 OS=Cavia porcellus GN=CLCN3 PE=2 SV=1 49 753 3.0E-176
sp|O18894|CLCN3_RABIT H(+)/Cl(-) exchange transporter 3 OS=Oryctolagus cuniculus GN=CLCN3 PE=2 SV=3 49 753 5.0E-176
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P0C197|CLCNX_USTMA Probable chloride channel protein UM03490-D OS=Ustilago maydis (strain 521 / FGSC 9021) GN=UMAG_11084 PE=3 SV=1 161 676 0.0E+00
sp|O60159|YHYB_SCHPO Putative anion/proton exchange transporter C19C7.11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC19C7.11 PE=3 SV=2 28 767 0.0E+00
sp|P51792|CLCN3_RAT H(+)/Cl(-) exchange transporter 3 OS=Rattus norvegicus GN=Clcn3 PE=2 SV=2 49 753 3.0E-176
sp|Q9R279|CLCN3_CAVPO H(+)/Cl(-) exchange transporter 3 OS=Cavia porcellus GN=CLCN3 PE=2 SV=1 49 753 3.0E-176
sp|O18894|CLCN3_RABIT H(+)/Cl(-) exchange transporter 3 OS=Oryctolagus cuniculus GN=CLCN3 PE=2 SV=3 49 753 5.0E-176
sp|P51790|CLCN3_HUMAN H(+)/Cl(-) exchange transporter 3 OS=Homo sapiens GN=CLCN3 PE=1 SV=2 49 753 5.0E-176
sp|P51791|CLCN3_MOUSE H(+)/Cl(-) exchange transporter 3 OS=Mus musculus GN=Clcn3 PE=1 SV=2 49 753 5.0E-176
sp|Q9TTU3|CLCN5_RABIT H(+)/Cl(-) exchange transporter 5 OS=Oryctolagus cuniculus GN=CLCN5 PE=2 SV=1 49 752 9.0E-172
sp|P51793|CLCN4_HUMAN H(+)/Cl(-) exchange transporter 4 OS=Homo sapiens GN=CLCN4 PE=1 SV=2 49 763 1.0E-170
sp|P51794|CLCN4_RAT H(+)/Cl(-) exchange transporter 4 OS=Rattus norvegicus GN=Clcn4 PE=2 SV=1 49 763 1.0E-169
sp|Q99P66|CLCN5_CAVPO H(+)/Cl(-) exchange transporter 5 OS=Cavia porcellus GN=CLCN5 PE=2 SV=1 49 752 3.0E-169
sp|Q61418|CLCN4_MOUSE H(+)/Cl(-) exchange transporter 4 OS=Mus musculus GN=Clcn4 PE=2 SV=2 49 763 4.0E-169
sp|Q5RDJ7|CLCN3_PONAB H(+)/Cl(-) exchange transporter 3 OS=Pongo abelii GN=CLCN3 PE=2 SV=1 49 753 7.0E-169
sp|P51796|CLCN5_RAT H(+)/Cl(-) exchange transporter 5 OS=Rattus norvegicus GN=Clcn5 PE=2 SV=1 49 769 6.0E-167
sp|Q9GKE7|CLCN5_PIG H(+)/Cl(-) exchange transporter 5 OS=Sus scrofa GN=CLCN5 PE=2 SV=1 49 752 9.0E-167
sp|Q5RBK4|CLCN5_PONAB H(+)/Cl(-) exchange transporter 5 OS=Pongo abelii GN=CLCN5 PE=2 SV=1 49 752 1.0E-166
sp|P51795|CLCN5_HUMAN H(+)/Cl(-) exchange transporter 5 OS=Homo sapiens GN=CLCN5 PE=1 SV=1 49 752 1.0E-166
sp|Q9WVD4|CLCN5_MOUSE H(+)/Cl(-) exchange transporter 5 OS=Mus musculus GN=Clcn5 PE=1 SV=1 49 752 3.0E-166
sp|P37020|GEF1_YEAST Anion/proton exchange transporter GEF1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GEF1 PE=1 SV=2 53 753 1.0E-148
sp|P92943|CLCD_ARATH Chloride channel protein CLC-d OS=Arabidopsis thaliana GN=CLC-D PE=1 SV=2 91 750 1.0E-60
sp|O94287|YOO2_SCHPO Uncharacterized chloride channel protein C887.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC887.02 PE=3 SV=2 138 757 3.0E-59
sp|O70496|CLCN7_MOUSE H(+)/Cl(-) exchange transporter 7 OS=Mus musculus GN=Clcn7 PE=1 SV=1 110 754 1.0E-58
sp|P51799|CLCN7_RAT H(+)/Cl(-) exchange transporter 7 OS=Rattus norvegicus GN=Clcn7 PE=2 SV=1 110 754 1.0E-58
sp|Q9BMK9|CLH3_CAEEL Chloride channel protein clh-3 OS=Caenorhabditis elegans GN=clh-3 PE=1 SV=1 173 656 2.0E-56
sp|Q64347|CLCN1_MOUSE Chloride channel protein 1 OS=Mus musculus GN=Clcn1 PE=1 SV=3 165 657 2.0E-52
sp|P35524|CLCN1_RAT Chloride channel protein 1 OS=Rattus norvegicus GN=Clcn1 PE=1 SV=1 165 657 3.0E-52
sp|Q75JF3|CLCC_DICDI Chloride channel protein C OS=Dictyostelium discoideum GN=clcC PE=3 SV=1 110 748 6.0E-52
sp|Q9WU45|CLCN2_CAVPO Chloride channel protein 2 OS=Cavia porcellus GN=CLCN2 PE=2 SV=1 173 688 7.0E-52
sp|P51798|CLCN7_HUMAN H(+)/Cl(-) exchange transporter 7 OS=Homo sapiens GN=CLCN7 PE=1 SV=2 110 760 2.0E-51
sp|P35523|CLCN1_HUMAN Chloride channel protein 1 OS=Homo sapiens GN=CLCN1 PE=1 SV=3 172 669 4.0E-51
sp|Q54C67|CLCF_DICDI Chloride channel protein F OS=Dictyostelium discoideum GN=clcF PE=3 SV=1 173 652 8.0E-51
sp|Q4PKH3|CLCN7_BOVIN H(+)/Cl(-) exchange transporter 7 OS=Bos taurus GN=CLCN7 PE=2 SV=1 110 754 1.0E-50
sp|Q9MZT1|CLCN1_CANLF Chloride channel protein 1 OS=Canis lupus familiaris GN=CLCN1 PE=1 SV=1 165 657 2.0E-50
sp|P51788|CLCN2_HUMAN Chloride channel protein 2 OS=Homo sapiens GN=CLCN2 PE=1 SV=2 173 651 4.0E-49
sp|P51789|CLCN2_RABIT Chloride channel protein 2 OS=Oryctolagus cuniculus GN=CLCN2 PE=2 SV=1 173 651 9.0E-49
sp|P35525|CLCN2_RAT Chloride channel protein 2 OS=Rattus norvegicus GN=Clcn2 PE=1 SV=1 173 679 2.0E-48
sp|Q9R0A1|CLCN2_MOUSE Chloride channel protein 2 OS=Mus musculus GN=Clcn2 PE=1 SV=2 173 679 2.0E-48
sp|P35522|CICH_TORCA Chloride channel protein OS=Torpedo californica PE=1 SV=3 173 657 7.0E-46
sp|P21564|CICH_TORMA Chloride channel protein OS=Torpedo marmorata PE=1 SV=1 173 657 2.0E-45
sp|P92941|CLCA_ARATH Chloride channel protein CLC-a OS=Arabidopsis thaliana GN=CLC-A PE=1 SV=2 101 753 4.0E-45
sp|Q9VGH7|CLCN2_DROME Chloride channel protein 2 OS=Drosophila melanogaster GN=ClC-a PE=2 SV=3 66 665 2.0E-44
sp|Q86AZ6|CLCB_DICDI Chloride channel protein B OS=Dictyostelium discoideum GN=clcB PE=3 SV=1 110 634 1.0E-43
sp|Q9W701|CLCKB_XENLA Chloride channel protein ClC-Kb OS=Xenopus laevis GN=clcnkb PE=1 SV=1 165 656 1.0E-41
sp|P92942|CLCB_ARATH Chloride channel protein CLC-b OS=Arabidopsis thaliana GN=CLC-B PE=1 SV=1 110 753 9.0E-41
sp|Q9TT16|CLCN6_RABIT Chloride transport protein 6 OS=Oryctolagus cuniculus GN=CLCN6 PE=2 SV=1 55 638 1.0E-40
sp|P51797|CLCN6_HUMAN Chloride transport protein 6 OS=Homo sapiens GN=CLCN6 PE=1 SV=2 55 638 8.0E-39
sp|Q54LQ4|CLCE_DICDI Chloride channel protein E OS=Dictyostelium discoideum GN=clcE PE=3 SV=1 176 666 2.0E-38
sp|O35454|CLCN6_MOUSE Chloride transport protein 6 OS=Mus musculus GN=Clcn6 PE=1 SV=1 55 587 4.0E-38
sp|P51804|CLCKB_RABIT Chloride channel protein ClC-Kb OS=Oryctolagus cuniculus GN=CLCNKB PE=2 SV=1 165 688 9.0E-37
sp|P51803|CLCKA_RABIT Chloride channel protein ClC-Ka OS=Oryctolagus cuniculus GN=CLCNKA PE=2 SV=1 165 688 1.0E-36
sp|Q9WUB6|CLCKB_MOUSE Chloride channel protein ClC-Kb OS=Mus musculus GN=Clcnkb PE=1 SV=2 165 651 2.0E-34
sp|Q96282|CLCC_ARATH Chloride channel protein CLC-c OS=Arabidopsis thaliana GN=CLC-C PE=1 SV=1 181 734 3.0E-34
sp|P60300|CLCG_ARATH Putative chloride channel-like protein CLC-g OS=Arabidopsis thaliana GN=CBSCLC6 PE=3 SV=2 110 734 7.0E-34
sp|Q06393|CLCKA_RAT Chloride channel protein ClC-Ka OS=Rattus norvegicus GN=Clcnka PE=1 SV=3 165 651 3.0E-32
sp|P51802|CLCKB_RAT Chloride channel protein ClC-Kb OS=Rattus norvegicus GN=Clcnkb PE=1 SV=1 165 651 8.0E-32
sp|Q9WUB7|CLCKA_MOUSE Chloride channel protein ClC-Ka OS=Mus musculus GN=Clcnka PE=1 SV=2 165 651 3.0E-31
sp|P51801|CLCKB_HUMAN Chloride channel protein ClC-Kb OS=Homo sapiens GN=CLCNKB PE=1 SV=3 173 663 4.0E-30
sp|P51800|CLCKA_HUMAN Chloride channel protein ClC-Ka OS=Homo sapiens GN=CLCNKA PE=1 SV=1 173 663 1.0E-29
sp|Q1ZXJ0|CLCD_DICDI Chloride channel protein D OS=Dictyostelium discoideum GN=clcD PE=3 SV=1 456 751 5.0E-25
sp|Q54AX6|CLCA_DICDI Chloride channel protein A OS=Dictyostelium discoideum GN=clcA PE=2 SV=1 61 406 4.0E-22
sp|Q1ZXJ0|CLCD_DICDI Chloride channel protein D OS=Dictyostelium discoideum GN=clcD PE=3 SV=1 173 397 4.0E-21
sp|Q54AX6|CLCA_DICDI Chloride channel protein A OS=Dictyostelium discoideum GN=clcA PE=2 SV=1 435 750 1.0E-20
sp|P0C197|CLCNX_USTMA Probable chloride channel protein UM03490-D OS=Ustilago maydis (strain 521 / FGSC 9021) GN=UMAG_11084 PE=3 SV=1 43 155 2.0E-17
sp|A8ALD3|CLCA_CITK8 H(+)/Cl(-) exchange transporter ClcA OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=clcA PE=3 SV=1 139 556 1.0E-15
sp|B5BL83|CLCA_SALPK H(+)/Cl(-) exchange transporter ClcA OS=Salmonella paratyphi A (strain AKU_12601) GN=clcA PE=3 SV=1 115 556 2.0E-14
sp|Q5PD50|CLCA_SALPA H(+)/Cl(-) exchange transporter ClcA OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=clcA PE=3 SV=1 115 556 2.0E-14
sp|A9N0Q1|CLCA_SALPB H(+)/Cl(-) exchange transporter ClcA OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=clcA PE=3 SV=1 111 556 9.0E-14
sp|B4SUY5|CLCA_SALNS H(+)/Cl(-) exchange transporter ClcA OS=Salmonella newport (strain SL254) GN=clcA PE=3 SV=1 111 556 9.0E-14
sp|B5R3G7|CLCA_SALEP H(+)/Cl(-) exchange transporter ClcA OS=Salmonella enteritidis PT4 (strain P125109) GN=clcA PE=3 SV=1 111 556 9.0E-14
sp|B4TXQ7|CLCA_SALSV H(+)/Cl(-) exchange transporter ClcA OS=Salmonella schwarzengrund (strain CVM19633) GN=clcA PE=3 SV=1 115 556 1.0E-13
sp|B5RHE1|CLCA_SALG2 H(+)/Cl(-) exchange transporter ClcA OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=clcA PE=3 SV=1 115 556 1.0E-13
sp|B4TK31|CLCA_SALHS H(+)/Cl(-) exchange transporter ClcA OS=Salmonella heidelberg (strain SL476) GN=clcA PE=3 SV=1 115 556 1.0E-13
sp|B5FJ02|CLCA_SALDC H(+)/Cl(-) exchange transporter ClcA OS=Salmonella dublin (strain CT_02021853) GN=clcA PE=3 SV=1 115 556 1.0E-13
sp|B5F8R6|CLCA_SALA4 H(+)/Cl(-) exchange transporter ClcA OS=Salmonella agona (strain SL483) GN=clcA PE=3 SV=1 115 556 1.0E-13
sp|C0Q5R6|CLCA_SALPC H(+)/Cl(-) exchange transporter ClcA OS=Salmonella paratyphi C (strain RKS4594) GN=clcA PE=3 SV=1 115 556 2.0E-13
sp|Q57T52|CLCA_SALCH H(+)/Cl(-) exchange transporter ClcA OS=Salmonella choleraesuis (strain SC-B67) GN=clcA PE=3 SV=1 115 556 2.0E-13
sp|B5Y1L4|CLCA_KLEP3 H(+)/Cl(-) exchange transporter ClcA OS=Klebsiella pneumoniae (strain 342) GN=clcA PE=3 SV=1 163 556 2.0E-13
sp|Q8ZRP8|CLCA_SALTY H(+)/Cl(-) exchange transporter ClcA OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=clcA PE=1 SV=1 115 556 2.0E-13
sp|Q8Z9B3|CLCA_SALTI H(+)/Cl(-) exchange transporter ClcA OS=Salmonella typhi GN=clcA PE=3 SV=1 115 556 2.0E-13
sp|A6T4V9|CLCA_KLEP7 H(+)/Cl(-) exchange transporter ClcA OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=clcA PE=3 SV=1 163 556 3.0E-13
sp|A9MPK6|CLCA_SALAR H(+)/Cl(-) exchange transporter ClcA OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=clcA PE=3 SV=1 111 556 4.0E-13
sp|Q8RXR2|CLCF_ARATH Chloride channel protein CLC-f OS=Arabidopsis thaliana GN=CLC-F PE=2 SV=2 227 637 1.0E-12
sp|P0C197|CLCNX_USTMA Probable chloride channel protein UM03490-D OS=Ustilago maydis (strain 521 / FGSC 9021) GN=UMAG_11084 PE=3 SV=1 698 751 2.0E-11
sp|A5F0D5|CLCA_VIBC3 H(+)/Cl(-) exchange transporter ClcA OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=clcA PE=3 SV=1 170 308 2.0E-10
sp|B2K549|CLCA_YERPB H(+)/Cl(-) exchange transporter ClcA OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=clcA PE=3 SV=1 172 308 2.0E-10
sp|A7FM08|CLCA_YERP3 H(+)/Cl(-) exchange transporter ClcA OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=clcA PE=3 SV=1 172 308 2.0E-10
sp|C3LVE3|CLCA_VIBCM H(+)/Cl(-) exchange transporter ClcA OS=Vibrio cholerae serotype O1 (strain M66-2) GN=clcA PE=3 SV=1 170 308 2.0E-10
sp|Q9KM62|CLCA_VIBCH H(+)/Cl(-) exchange transporter ClcA OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=clcA PE=3 SV=1 170 308 2.0E-10
sp|A7MGR4|CLCA_CROS8 H(+)/Cl(-) exchange transporter ClcA OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=clcA PE=3 SV=1 192 556 2.0E-10
sp|B1JK21|CLCA_YERPY H(+)/Cl(-) exchange transporter ClcA OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=clcA PE=3 SV=1 172 308 3.0E-10
sp|A4TPW7|CLCA_YERPP H(+)/Cl(-) exchange transporter ClcA OS=Yersinia pestis (strain Pestoides F) GN=clcA PE=3 SV=1 172 308 3.0E-10
sp|Q1CLU6|CLCA_YERPN H(+)/Cl(-) exchange transporter ClcA OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=clcA PE=3 SV=1 172 308 3.0E-10
sp|A9R1E4|CLCA_YERPG H(+)/Cl(-) exchange transporter ClcA OS=Yersinia pestis bv. Antiqua (strain Angola) GN=clcA PE=3 SV=1 172 308 3.0E-10
sp|Q8ZBM0|CLCA_YERPE H(+)/Cl(-) exchange transporter ClcA OS=Yersinia pestis GN=clcA PE=3 SV=1 172 308 3.0E-10
sp|Q1C3X2|CLCA_YERPA H(+)/Cl(-) exchange transporter ClcA OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=clcA PE=3 SV=1 172 308 3.0E-10
sp|Q8XTT4|CLCL_RALSO Putative chloride channel protein ClcB-like OS=Ralstonia solanacearum (strain GMI1000) GN=RSp0020 PE=3 SV=2 216 556 2.0E-09
sp|Q87GZ9|CLCA_VIBPA H(+)/Cl(-) exchange transporter ClcA OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=clcA PE=3 SV=1 175 331 1.0E-08
sp|Q325Y4|CLCA_SHIBS H(+)/Cl(-) exchange transporter ClcA OS=Shigella boydii serotype 4 (strain Sb227) GN=clcA PE=3 SV=1 172 571 5.0E-08
sp|Q1RG33|CLCA_ECOUT H(+)/Cl(-) exchange transporter ClcA OS=Escherichia coli (strain UTI89 / UPEC) GN=clcA PE=3 SV=1 172 571 2.0E-07
sp|Q8FL15|CLCA_ECOL6 H(+)/Cl(-) exchange transporter ClcA OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=clcA PE=3 SV=1 172 571 2.0E-07
sp|A1A7K1|CLCA_ECOK1 H(+)/Cl(-) exchange transporter ClcA OS=Escherichia coli O1:K1 / APEC GN=clcA PE=3 SV=1 172 571 2.0E-07
sp|B7MBD8|CLCA_ECO45 H(+)/Cl(-) exchange transporter ClcA OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=clcA PE=3 SV=1 172 571 2.0E-07
sp|B2U300|CLCA_SHIB3 H(+)/Cl(-) exchange transporter ClcA OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=clcA PE=3 SV=1 172 571 2.0E-07
sp|Q32JV3|CLCA_SHIDS H(+)/Cl(-) exchange transporter ClcA OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=clcA PE=3 SV=1 172 571 2.0E-07
sp|B1LGV8|CLCA_ECOSM H(+)/Cl(-) exchange transporter ClcA OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=clcA PE=3 SV=1 172 571 2.0E-07
sp|Q0TLH6|CLCA_ECOL5 H(+)/Cl(-) exchange transporter ClcA OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=clcA PE=3 SV=1 172 571 2.0E-07
sp|B7MP17|CLCA_ECO81 H(+)/Cl(-) exchange transporter ClcA OS=Escherichia coli O81 (strain ED1a) GN=clcA PE=3 SV=1 172 571 2.0E-07
sp|B7NIB8|CLCA_ECO7I H(+)/Cl(-) exchange transporter ClcA OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=clcA PE=3 SV=1 172 571 2.0E-07
sp|B5Z0D5|CLCA_ECO5E H(+)/Cl(-) exchange transporter ClcA OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=clcA PE=3 SV=1 172 571 2.0E-07
sp|P58244|CLCA_ECO57 H(+)/Cl(-) exchange transporter ClcA OS=Escherichia coli O157:H7 GN=clcA PE=3 SV=1 172 571 2.0E-07
sp|Q3Z5K2|CLCA_SHISS H(+)/Cl(-) exchange transporter ClcA OS=Shigella sonnei (strain Ss046) GN=clcA PE=1 SV=1 172 571 2.0E-07
sp|B6HZD1|CLCA_ECOSE H(+)/Cl(-) exchange transporter ClcA OS=Escherichia coli (strain SE11) GN=clcA PE=3 SV=1 172 571 2.0E-07
sp|B7N824|CLCA_ECOLU H(+)/Cl(-) exchange transporter ClcA OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=clcA PE=3 SV=1 172 571 2.0E-07
sp|P37019|CLCA_ECOLI H(+)/Cl(-) exchange transporter ClcA OS=Escherichia coli (strain K12) GN=clcA PE=1 SV=2 172 571 2.0E-07
sp|B1IQI5|CLCA_ECOLC H(+)/Cl(-) exchange transporter ClcA OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=clcA PE=3 SV=1 172 571 2.0E-07
sp|B1XD25|CLCA_ECODH H(+)/Cl(-) exchange transporter ClcA OS=Escherichia coli (strain K12 / DH10B) GN=clcA PE=3 SV=1 172 571 2.0E-07
sp|C4ZRP8|CLCA_ECOBW H(+)/Cl(-) exchange transporter ClcA OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=clcA PE=3 SV=1 172 571 2.0E-07
sp|B7M196|CLCA_ECO8A H(+)/Cl(-) exchange transporter ClcA OS=Escherichia coli O8 (strain IAI1) GN=clcA PE=3 SV=1 172 571 2.0E-07
sp|B7LGL7|CLCA_ECO55 H(+)/Cl(-) exchange transporter ClcA OS=Escherichia coli (strain 55989 / EAEC) GN=clcA PE=3 SV=1 172 571 2.0E-07
sp|B7UIK2|CLCA_ECO27 H(+)/Cl(-) exchange transporter ClcA OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=clcA PE=3 SV=1 172 571 2.0E-07
sp|A7ZHP7|CLCA_ECO24 H(+)/Cl(-) exchange transporter ClcA OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=clcA PE=3 SV=1 172 571 2.0E-07
sp|B7LWB6|CLCA_ESCF3 H(+)/Cl(-) exchange transporter ClcA OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=clcA PE=3 SV=1 172 571 2.0E-07
sp|Q8ZEB3|CLCB_YERPE Voltage-gated ClC-type chloride channel ClcB OS=Yersinia pestis GN=clcB PE=3 SV=2 227 492 3.0E-07
sp|A7ZWA3|CLCA_ECOHS H(+)/Cl(-) exchange transporter ClcA OS=Escherichia coli O9:H4 (strain HS) GN=clcA PE=3 SV=1 172 571 3.0E-07
sp|Q9AGD5|CLCB_YERPS Voltage-gated ClC-type chloride channel ClcB OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=clcB PE=3 SV=3 227 492 6.0E-07
sp|A7FHW4|CLCB_YERP3 Voltage-gated ClC-type chloride channel ClcB OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=clcB PE=3 SV=1 227 492 6.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0005247 voltage-gated chloride channel activity Yes
GO:0055085 transmembrane transport Yes
GO:0016020 membrane Yes
GO:0006821 chloride transport Yes
GO:0022832 voltage-gated channel activity No
GO:0006820 anion transport No
GO:0015108 chloride transmembrane transporter activity No
GO:0015075 ion transmembrane transporter activity No
GO:0008308 voltage-gated anion channel activity No
GO:0022803 passive transmembrane transporter activity No
GO:0051234 establishment of localization No
GO:0005253 anion channel activity No
GO:0022839 ion gated channel activity No
GO:0005254 chloride channel activity No
GO:0005216 ion channel activity No
GO:0022836 gated channel activity No
GO:0051179 localization No
GO:0022838 substrate-specific channel activity No
GO:0015698 inorganic anion transport No
GO:0006811 ion transport No
GO:0005244 voltage-gated ion channel activity No
GO:0006810 transport No
GO:0022857 transmembrane transporter activity No
GO:0005215 transporter activity No
GO:0015267 channel activity No
GO:0008150 biological_process No
GO:0015318 inorganic molecular entity transmembrane transporter activity No
GO:0008509 anion transmembrane transporter activity No
GO:0015103 inorganic anion transmembrane transporter activity No
GO:0003674 molecular_function No
GO:0005575 cellular_component No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

Domain # Start End Length
1 109 131 22
2 177 199 22
3 220 242 22
4 277 299 22
5 312 334 22
6 354 376 22
7 389 411 22
8 442 464 22
9 471 493 22
10 518 540 22
11 547 569 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|7290
MNSRSAPGGRSSQVFRRPSITSRLSFAVSSAERGEASSADPAAASPVPIDEAIAEIKRYEDFTTIDWVQDAAREQ
ARRKTRRKRAAGLYGRSRSAWRYRLWESYDAAQGWIVVTIIGVAIGLNAAFLNIVTEWLSDIKTGHCSTAFYLNE
NFCCWGEDNGCPHWHRWTGFEPLNYLIYILFATFFAFVSATLVKSFAPYAAGSGISEIKCVIAGFVMKGFLGFRT
LVIKSVCLPLAIGSGLSVGKEGPSVHYAVCTGNVISRLFAKYRSNASKTREILSACAAAGVAVAFGSPIGGVLFS
LEEMSNYFPLKTMWRSYFCALVATAVLAALNPFRTGQLVMFQVKYDRDWHFFEVVFYILIGVFGGLYGALVIKWN
LRAQAFRKKYLTRYAVLEATLLAAGTAVLAYPNAFLRIDMTESMEILFLECEGAEDYHGLCESDRQMWNIVSLVS
ATALRLFLVIISYGCKVPAGIFVPSMAIGASFGRTIGTIVQIIHEANPTSIFFSACKPDEPCITPGTYAFLGAAA
ALSGIMHITVSVVVIMFELTGALTYILPTMIVVGVTKAVSSWFGKGGIADRMIWFSGFPFLDNKEEHNFGVPVSQ
VMRTSVVSLPASGLTLGEVEQLLSDDKYQGFPIVEDDKSKTLVGYIGRTELRYGIDRIRRERPIDEGVRCVFAPP
PPTTAMMTPTMTVSTESMASTSLDFSRYVDATPVTAHPRLPLETVMELFRKIGPRVILVDYHGRLTGLVTVKDCL
KYQFKVEAAESPKDDQRILEGQAQLWAVLHRAGHWVSDQVSSVSGGRIRLSGQFDEDRPQQPGRGGPILDGDEDA
ADESVELENRGG*
Coding >Hirsu2|7290
ATGAACTCACGATCCGCCCCGGGCGGCCGGAGCTCGCAAGTCTTCCGCCGCCCGTCCATCACGTCGCGCCTCTCC
TTCGCCGTCTCCAGCGCCGAGCGCGGCGAGGCCTCCTCCGCCGATCCCGCCGCCGCCTCGCCCGTTCCGATCGAC
GAGGCCATCGCCGAGATCAAGCGATACGAGGACTTTACCACGATCGACTGGGTACAGGATGCGGCGCGAGAGCAG
GCCAGGCGCAAGACGCGCCGGAAACGAGCGGCCGGTCTCTACGGCCGCAGCCGATCTGCCTGGCGATACCGTCTG
TGGGAGTCGTACGACGCCGCCCAGGGATGGATTGTCGTCACCATCATCGGCGTTGCCATCGGCTTGAATGCCGCC
TTTCTCAACATCGTCACCGAGTGGCTGTCTGACATCAAGACCGGCCACTGCTCCACCGCCTTCTACCTCAACGAG
AACTTTTGCTGCTGGGGCGAGGACAACGGCTGCCCGCACTGGCATCGTTGGACTGGTTTCGAGCCCCTCAACTAT
CTCATCTACATCCTCTTTGCCACCTTCTTCGCCTTCGTTTCGGCCACGCTCGTCAAGTCCTTTGCGCCGTACGCC
GCCGGCTCCGGCATCTCGGAGATCAAGTGCGTCATTGCCGGCTTTGTCATGAAGGGCTTCCTCGGCTTCCGGACC
CTGGTCATCAAGTCGGTCTGCCTGCCGCTGGCCATCGGCTCCGGCCTGTCCGTCGGCAAGGAAGGGCCGAGCGTC
CACTACGCCGTCTGCACCGGCAATGTCATCTCGCGCCTCTTCGCCAAGTACAGGAGCAACGCGTCCAAGACGCGC
GAGATACTGAGCGCCTGCGCCGCCGCCGGCGTCGCCGTCGCCTTTGGCAGTCCCATCGGCGGCGTGCTCTTCTCG
CTCGAGGAAATGTCCAACTACTTCCCGCTCAAGACGATGTGGCGCAGCTACTTCTGCGCCCTGGTCGCGACGGCC
GTTCTGGCCGCCTTGAACCCCTTTCGCACCGGGCAGCTGGTCATGTTCCAGGTCAAGTACGACCGCGACTGGCAC
TTCTTCGAGGTCGTCTTCTACATCCTGATCGGCGTCTTCGGCGGCCTCTACGGCGCCTTGGTCATCAAGTGGAAC
CTGCGCGCGCAGGCCTTCCGCAAGAAGTACCTGACGCGGTACGCGGTGCTGGAGGCGACGCTGCTGGCCGCCGGC
ACAGCCGTCCTGGCCTACCCCAACGCCTTCCTGCGCATCGACATGACGGAGAGCATGGAGATTCTCTTCCTCGAG
TGCGAGGGGGCCGAGGACTACCACGGCCTGTGCGAGTCGGACCGGCAGATGTGGAACATCGTCTCGCTGGTGTCG
GCGACGGCGCTGCGCCTCTTCCTCGTCATCATCTCGTACGGCTGCAAGGTGCCAGCGGGCATCTTTGTGCCGTCC
ATGGCCATCGGCGCCTCGTTCGGGCGGACCATCGGCACCATCGTCCAGATTATCCACGAGGCAAACCCGACCAGC
ATCTTCTTCTCGGCCTGCAAGCCAGACGAGCCGTGCATCACGCCCGGCACGTACGCCTTCCTCGGCGCGGCGGCG
GCCCTGAGCGGCATCATGCACATCACCGTCTCGGTCGTCGTCATCATGTTCGAGCTGACGGGGGCGCTGACGTAC
ATCCTGCCGACCATGATCGTCGTCGGCGTCACCAAGGCCGTCAGCAGCTGGTTCGGCAAGGGCGGCATCGCGGAC
CGGATGATCTGGTTCAGCGGCTTCCCCTTCCTTGACAACAAGGAGGAGCACAACTTCGGGGTGCCCGTGTCGCAG
GTGATGAGGACGTCGGTCGTGTCGCTGCCCGCCAGCGGCCTAACGCTCGGCGAGGTGGAGCAGCTGCTGTCGGAC
GACAAGTACCAGGGCTTCCCGATCGTCGAGGACGACAAGTCCAAGACGTTGGTGGGTTACATCGGCCGAACCGAG
CTGCGGTACGGCATCGACCGCATTCGCCGGGAGCGGCCGATCGACGAGGGCGTCCGGTGCGTGTTCGCGCCGCCG
CCGCCGACGACGGCCATGATGACGCCGACGATGACGGTCAGCACCGAGTCGATGGCCTCGACGTCGCTCGACTTC
AGCCGCTACGTCGACGCGACGCCGGTGACGGCCCACCCGCGACTGCCGCTGGAGACGGTCATGGAGCTGTTCCGC
AAGATCGGGCCGCGCGTCATCCTCGTCGACTACCACGGCCGGCTGACGGGCCTGGTGACGGTCAAGGACTGCCTC
AAGTACCAGTTTAAGGTGGAGGCGGCCGAGAGCCCCAAGGACGACCAGCGCATCCTCGAGGGCCAGGCGCAGTTG
TGGGCCGTGCTGCACCGAGCCGGCCACTGGGTCTCGGACCAGGTCTCGAGCGTGTCGGGCGGTCGCATCCGGCTG
AGCGGACAGTTCGACGAGGACAGGCCGCAGCAGCCCGGCCGGGGCGGGCCGATTCTGGACGGCGACGAGGACGCG
GCCGACGAGAGCGTAGAGCTGGAGAATAGGGGGGGATAA
Transcript >Hirsu2|7290
ATGAACTCACGATCCGCCCCGGGCGGCCGGAGCTCGCAAGTCTTCCGCCGCCCGTCCATCACGTCGCGCCTCTCC
TTCGCCGTCTCCAGCGCCGAGCGCGGCGAGGCCTCCTCCGCCGATCCCGCCGCCGCCTCGCCCGTTCCGATCGAC
GAGGCCATCGCCGAGATCAAGCGATACGAGGACTTTACCACGATCGACTGGGTACAGGATGCGGCGCGAGAGCAG
GCCAGGCGCAAGACGCGCCGGAAACGAGCGGCCGGTCTCTACGGCCGCAGCCGATCTGCCTGGCGATACCGTCTG
TGGGAGTCGTACGACGCCGCCCAGGGATGGATTGTCGTCACCATCATCGGCGTTGCCATCGGCTTGAATGCCGCC
TTTCTCAACATCGTCACCGAGTGGCTGTCTGACATCAAGACCGGCCACTGCTCCACCGCCTTCTACCTCAACGAG
AACTTTTGCTGCTGGGGCGAGGACAACGGCTGCCCGCACTGGCATCGTTGGACTGGTTTCGAGCCCCTCAACTAT
CTCATCTACATCCTCTTTGCCACCTTCTTCGCCTTCGTTTCGGCCACGCTCGTCAAGTCCTTTGCGCCGTACGCC
GCCGGCTCCGGCATCTCGGAGATCAAGTGCGTCATTGCCGGCTTTGTCATGAAGGGCTTCCTCGGCTTCCGGACC
CTGGTCATCAAGTCGGTCTGCCTGCCGCTGGCCATCGGCTCCGGCCTGTCCGTCGGCAAGGAAGGGCCGAGCGTC
CACTACGCCGTCTGCACCGGCAATGTCATCTCGCGCCTCTTCGCCAAGTACAGGAGCAACGCGTCCAAGACGCGC
GAGATACTGAGCGCCTGCGCCGCCGCCGGCGTCGCCGTCGCCTTTGGCAGTCCCATCGGCGGCGTGCTCTTCTCG
CTCGAGGAAATGTCCAACTACTTCCCGCTCAAGACGATGTGGCGCAGCTACTTCTGCGCCCTGGTCGCGACGGCC
GTTCTGGCCGCCTTGAACCCCTTTCGCACCGGGCAGCTGGTCATGTTCCAGGTCAAGTACGACCGCGACTGGCAC
TTCTTCGAGGTCGTCTTCTACATCCTGATCGGCGTCTTCGGCGGCCTCTACGGCGCCTTGGTCATCAAGTGGAAC
CTGCGCGCGCAGGCCTTCCGCAAGAAGTACCTGACGCGGTACGCGGTGCTGGAGGCGACGCTGCTGGCCGCCGGC
ACAGCCGTCCTGGCCTACCCCAACGCCTTCCTGCGCATCGACATGACGGAGAGCATGGAGATTCTCTTCCTCGAG
TGCGAGGGGGCCGAGGACTACCACGGCCTGTGCGAGTCGGACCGGCAGATGTGGAACATCGTCTCGCTGGTGTCG
GCGACGGCGCTGCGCCTCTTCCTCGTCATCATCTCGTACGGCTGCAAGGTGCCAGCGGGCATCTTTGTGCCGTCC
ATGGCCATCGGCGCCTCGTTCGGGCGGACCATCGGCACCATCGTCCAGATTATCCACGAGGCAAACCCGACCAGC
ATCTTCTTCTCGGCCTGCAAGCCAGACGAGCCGTGCATCACGCCCGGCACGTACGCCTTCCTCGGCGCGGCGGCG
GCCCTGAGCGGCATCATGCACATCACCGTCTCGGTCGTCGTCATCATGTTCGAGCTGACGGGGGCGCTGACGTAC
ATCCTGCCGACCATGATCGTCGTCGGCGTCACCAAGGCCGTCAGCAGCTGGTTCGGCAAGGGCGGCATCGCGGAC
CGGATGATCTGGTTCAGCGGCTTCCCCTTCCTTGACAACAAGGAGGAGCACAACTTCGGGGTGCCCGTGTCGCAG
GTGATGAGGACGTCGGTCGTGTCGCTGCCCGCCAGCGGCCTAACGCTCGGCGAGGTGGAGCAGCTGCTGTCGGAC
GACAAGTACCAGGGCTTCCCGATCGTCGAGGACGACAAGTCCAAGACGTTGGTGGGTTACATCGGCCGAACCGAG
CTGCGGTACGGCATCGACCGCATTCGCCGGGAGCGGCCGATCGACGAGGGCGTCCGGTGCGTGTTCGCGCCGCCG
CCGCCGACGACGGCCATGATGACGCCGACGATGACGGTCAGCACCGAGTCGATGGCCTCGACGTCGCTCGACTTC
AGCCGCTACGTCGACGCGACGCCGGTGACGGCCCACCCGCGACTGCCGCTGGAGACGGTCATGGAGCTGTTCCGC
AAGATCGGGCCGCGCGTCATCCTCGTCGACTACCACGGCCGGCTGACGGGCCTGGTGACGGTCAAGGACTGCCTC
AAGTACCAGTTTAAGGTGGAGGCGGCCGAGAGCCCCAAGGACGACCAGCGCATCCTCGAGGGCCAGGCGCAGTTG
TGGGCCGTGCTGCACCGAGCCGGCCACTGGGTCTCGGACCAGGTCTCGAGCGTGTCGGGCGGTCGCATCCGGCTG
AGCGGACAGTTCGACGAGGACAGGCCGCAGCAGCCCGGCCGGGGCGGGCCGATTCTGGACGGCGACGAGGACGCG
GCCGACGAGAGCGTAGAGCTGGAGAATAGGGGGGGATAA
Gene >Hirsu2|7290
ATGAACTCACGATCCGCCCCGGGCGGCCGGAGCTCGCAAGTCTTCCGCCGCCCGTCCATCACGTCGCGCCTCTCC
TTCGCCGTCTCCAGCGCCGAGCGCGGCGAGGCCTCCTCCGCCGATCCCGCCGCCGCCTCGCCCGTTCCGATCGAC
GAGGCCATCGCCGAGATCAAGCGATACGAGGTGAGCCTGCCGCCCTTCTTGCCCCGACCGTGGCCATCGCTGACG
CGGAGCAGGACTTTACCACGATCGGTACGATGTCTCCCTCTCGCCCGAGCCCTATACCCGGTCCACGCTGCCGCT
GACCCCGTCCCCTTTTCTCTCTCTCCCGGCAGACTGGGTACAGGATGCGGCGCGAGAGCAGGCCAGGCGCAAGAC
GCGCCGGAAACGAGCGGCCGGTCTCTACGGCCGCAGCCGATCTGCCTGGCGATACCGTCTGTGGGAGTCGTACGA
CGCCGCCCAGGGATGGATTGTCGTCACCATCATCGGCGTTGCCATCGGCTTGAATGCCGCCTTTCTCAACATCGT
CACCGAGTGGCTGTCTGACATCAAGACCGGCCACTGCTCCACCGCCTTCTACCTCAACGAGAACTTTTGCTGCTG
GGGCGAGGACAACGGTATGGCCTTCCTCTCTCGTAACGCTGCCAGGCCGCTCGCTGACCTGGCCGCTCTCTTGCA
AAACGCACAAAGGCTGCCCGCACTGGCATCGTTGGACTGGTTTCGAGCCCCTCAACTATCTCATCTACATCCTCT
TTGCCGTACGTCGACCCTTGCCATCGCCGCCTCCTTCCCCGTCCTGACGCACGAGTAGACCTTCTTCGCCTTCGT
TTCGGCCACGCTCGTCAAGTCCTTTGCGCCGTACGCCGCCGGCTCCGGCATCTCGGAGATCAAGTGCGTCATTGC
CGGCTTTGTCATGAAGGGCTTCCTCGGCTTCCGGACCCTGGTCATCAAGTCGGTCTGCCTGCCGCTGGCCATCGG
CTCCGGCCTGTCCGTCGGCAAGGAAGGGCCGAGCGTCCACTACGCCGTCTGCACCGGCAATGTCATCTCGCGCCT
CTTCGCCAAGTACAGGAGCAACGCGTCCAAGACGCGCGAGATACTGAGCGCCTGCGCCGCCGCCGGCGTCGCCGT
CGCCTTTGGCAGTCCCATCGGCGGCGTGCTCTTCTCGCTCGAGGAAATGTCCAACTACTTCCCGCTCAAGACGAT
GTGGCGCAGCTACTTCTGCGCCCTGGTCGCGACGGCCGTTCTGGCCGCCTTGAACCCCTTTCGCACCGGGCAGCT
GGTCATGTTCCAGGTCAAGTACGACCGCGACTGGCACTTCTTCGAGGTCGTCTTCTACATCCTGATCGGCGTCTT
CGGCGGCCTCTACGGCGCCTTGGTCATCAAGTGGAACCTGCGCGCGCAGGCCTTCCGCAAGAAGTACCTGACGCG
GTACGCGGTGCTGGAGGCGACGCTGCTGGCCGCCGGCACAGCCGTCCTGGCCTACCCCAACGCCTTCCTGCGCAT
CGACATGACGGAGAGCATGGAGATTCTCTTCCTCGAGTGCGAGGGGGCCGAGGACTACCACGGCCTGTGCGAGTC
GGACCGGCAGATGTGGAACATCGTCTCGCTGGTGTCGGCGACGGCGCTGCGCCTCTTCCTCGTCATCATCTCGTA
CGGCTGCAAGGTGCCAGCGGGCATCTTTGTGCCGTCCATGGCCATCGGCGCCTCGTTCGGGCGGACCATCGGCAC
CATCGTCCAGATTATCCACGAGGCAAACCCGACCAGCATCTTCTTCTCGGCCTGCAAGCCAGACGAGCCGTGCAT
CACGCCCGGCACGTACGCCTTCCTCGGCGCGGCGGCGGCCCTGAGCGGCATCATGCACATCACCGTCTCGGTCGT
CGTCATCATGTTCGAGCTGACGGGGGCGCTGACGTACATCCTGCCGACCATGATCGTCGTCGGCGTCACCAAGGC
CGTCAGCAGCTGGTTCGGCAAGGGCGGCATCGCGGACCGGATGATCTGGTTCAGCGGCTTCCCCTTCCTTGACAA
CAAGGAGGAGCACAACTTCGGGGTGCCCGTGTCGCAGGTGATGAGGACGTCGGTCGTGTCGCTGCCCGCCAGCGG
CCTAACGCTCGGCGAGGTGGAGCAGCTGCTGTCGGACGACAAGTACCAGGGCTTCCCGATCGTCGAGGACGACAA
GTCCAAGACGTTGGTGGGTTACATCGGCCGAACCGAGCTGCGGTACGGCATCGACCGCATTCGCCGGGAGCGGCC
GATCGACGAGGGCGTCCGGTGCGTGTTCGCGCCGCCGCCGCCGACGACGGCCATGATGACGCCGACGATGACGGT
CAGCACCGAGTCGATGGCCTCGACGTCGCTCGACTTCAGCCGCTACGTCGACGCGACGCCGGTGACGGCCCACCC
GCGACTGCCGCTGGAGACGGTCATGGAGCTGTTCCGCAAGATCGGGCCGCGCGTCATCCTCGTCGACTACCACGG
CCGGCTGACGGGCCTGGTGACGGTCAAGGACTGCCTCAAGTACCAGTTTAAGGTGGAGGCGGCCGAGAGCCCCAA
GGACGACCAGCGCATCCTCGAGGGCCAGGCGCAGTTGTGGGCCGTGCTGCACCGAGCCGGCCACTGGGTCTCGGA
CCAGGTCTCGAGCGTGTCGGGCGGTCGCATCCGGCTGAGCGGACAGTTCGACGAGGACAGGCCGCAGCAGCCCGG
CCGGGGCGGGCCGATTCTGGACGGCGACGAGGACGCGGCCGACGAGAGCGTAGAGCTGGAGAATAGGGGGGGATA
A

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail