Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|7287
Gene name
LocationContig_414:7898..12586
Strand+
Gene length (bp)4688
Transcript length (bp)4623
Coding sequence length (bp)4623
Protein length (aa) 1541

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00069 Pkinase Protein kinase domain 1.5E-21 27 287
PF00400 WD40 WD domain, G-beta repeat 5.4E-05 1108 1144
PF07714 Pkinase_Tyr Protein tyrosine kinase 1.3E-06 26 165

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9UVG6|VPS15_PICPA Putative serine/threonine-protein kinase VPS15 OS=Komagataella pastoris GN=VPS15 PE=3 SV=3 1 884 0.0E+00
sp|O42900|PPK19_SCHPO Serine/threonine-protein kinase ppk19 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppk19 PE=1 SV=1 21 1338 2.0E-175
sp|P22219|VPS15_YEAST Serine/threonine-protein kinase VPS15 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VPS15 PE=1 SV=4 1 877 1.0E-153
sp|Q99570|PI3R4_HUMAN Phosphoinositide 3-kinase regulatory subunit 4 OS=Homo sapiens GN=PIK3R4 PE=1 SV=3 19 874 2.0E-149
sp|Q8VD65|PI3R4_MOUSE Phosphoinositide 3-kinase regulatory subunit 4 OS=Mus musculus GN=Pik3r4 PE=1 SV=3 19 874 3.0E-143
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9UVG6|VPS15_PICPA Putative serine/threonine-protein kinase VPS15 OS=Komagataella pastoris GN=VPS15 PE=3 SV=3 1 884 0.0E+00
sp|O42900|PPK19_SCHPO Serine/threonine-protein kinase ppk19 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppk19 PE=1 SV=1 21 1338 2.0E-175
sp|P22219|VPS15_YEAST Serine/threonine-protein kinase VPS15 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VPS15 PE=1 SV=4 1 877 1.0E-153
sp|Q99570|PI3R4_HUMAN Phosphoinositide 3-kinase regulatory subunit 4 OS=Homo sapiens GN=PIK3R4 PE=1 SV=3 19 874 2.0E-149
sp|Q8VD65|PI3R4_MOUSE Phosphoinositide 3-kinase regulatory subunit 4 OS=Mus musculus GN=Pik3r4 PE=1 SV=3 19 874 3.0E-143
sp|P0C0R5|PI3R4_RAT Phosphoinositide 3-kinase regulatory subunit 4 OS=Rattus norvegicus GN=Pik3r4 PE=3 SV=2 19 874 4.0E-143
sp|Q5R9I3|PI3R4_PONAB Phosphoinositide 3-kinase regulatory subunit 4 OS=Pongo abelii GN=PIK3R4 PE=2 SV=3 19 874 2.0E-142
sp|Q54S77|VPS15_DICDI Probable serine/threonine-protein kinase vps15 OS=Dictyostelium discoideum GN=vps15 PE=3 SV=1 25 343 3.0E-77
sp|Q54S77|VPS15_DICDI Probable serine/threonine-protein kinase vps15 OS=Dictyostelium discoideum GN=vps15 PE=3 SV=1 394 763 3.0E-44
sp|Q9UVG6|VPS15_PICPA Putative serine/threonine-protein kinase VPS15 OS=Komagataella pastoris GN=VPS15 PE=3 SV=3 1047 1540 6.0E-40
sp|Q54S77|VPS15_DICDI Probable serine/threonine-protein kinase vps15 OS=Dictyostelium discoideum GN=vps15 PE=3 SV=1 1100 1352 1.0E-35
sp|Q8VD65|PI3R4_MOUSE Phosphoinositide 3-kinase regulatory subunit 4 OS=Mus musculus GN=Pik3r4 PE=1 SV=3 1102 1442 4.0E-34
sp|P0C0R5|PI3R4_RAT Phosphoinositide 3-kinase regulatory subunit 4 OS=Rattus norvegicus GN=Pik3r4 PE=3 SV=2 1102 1442 4.0E-34
sp|Q99570|PI3R4_HUMAN Phosphoinositide 3-kinase regulatory subunit 4 OS=Homo sapiens GN=PIK3R4 PE=1 SV=3 1102 1442 5.0E-34
sp|Q5R9I3|PI3R4_PONAB Phosphoinositide 3-kinase regulatory subunit 4 OS=Pongo abelii GN=PIK3R4 PE=2 SV=3 1102 1442 2.0E-32
sp|P22219|VPS15_YEAST Serine/threonine-protein kinase VPS15 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VPS15 PE=1 SV=4 1003 1348 3.0E-27
sp|P0C8M8|CCR1_MAIZE Probable serine/threonine-protein kinase CCRP1 OS=Zea mays GN=CCRP1 PE=1 SV=1 29 298 1.0E-13
sp|Q96L34|MARK4_HUMAN MAP/microtubule affinity-regulating kinase 4 OS=Homo sapiens GN=MARK4 PE=1 SV=1 29 297 3.0E-11
sp|Q8CIP4|MARK4_MOUSE MAP/microtubule affinity-regulating kinase 4 OS=Mus musculus GN=Mark4 PE=1 SV=1 29 297 3.0E-11
sp|Q6ERS0|CIPKR_ORYSJ Putative CBL-interacting protein kinase 27 OS=Oryza sativa subsp. japonica GN=CIPK27 PE=3 SV=1 26 408 5.0E-11
sp|Q8CFH6|SIK2_MOUSE Serine/threonine-protein kinase SIK2 OS=Mus musculus GN=Sik2 PE=1 SV=1 28 287 1.0E-10
sp|Q94CG0|CIPKL_ARATH CBL-interacting serine/threonine-protein kinase 21 OS=Arabidopsis thaliana GN=CIPK21 PE=1 SV=1 26 375 1.0E-10
sp|Q93VD3|CIPKN_ARATH CBL-interacting serine/threonine-protein kinase 23 OS=Arabidopsis thaliana GN=CIPK23 PE=1 SV=1 26 326 3.0E-10
sp|Q60670|SIK1_MOUSE Serine/threonine-protein kinase SIK1 OS=Mus musculus GN=Sik1 PE=1 SV=3 28 284 3.0E-10
sp|Q5REX1|SIK2_PONAB Serine/threonine-protein kinase SIK2 OS=Pongo abelii GN=SIK2 PE=2 SV=1 28 287 4.0E-10
sp|A0AUV4|SMKY_MOUSE Sperm motility kinase Y OS=Mus musculus GN=Gm7168 PE=2 SV=1 26 287 6.0E-10
sp|Q5JLS2|CIPKC_ORYSJ CBL-interacting protein kinase 12 OS=Oryza sativa subsp. japonica GN=CIPK12 PE=1 SV=1 26 299 8.0E-10
sp|O08679|MARK2_RAT Serine/threonine-protein kinase MARK2 OS=Rattus norvegicus GN=Mark2 PE=1 SV=1 29 287 8.0E-10
sp|Q9Y2K2|SIK3_HUMAN Serine/threonine-protein kinase SIK3 OS=Homo sapiens GN=SIK3 PE=1 SV=3 26 284 8.0E-10
sp|Q05512|MARK2_MOUSE Serine/threonine-protein kinase MARK2 OS=Mus musculus GN=Mark2 PE=1 SV=3 29 287 8.0E-10
sp|Q9H0K1|SIK2_HUMAN Serine/threonine-protein kinase SIK2 OS=Homo sapiens GN=SIK2 PE=1 SV=1 28 287 1.0E-09
sp|Q7KZI7|MARK2_HUMAN Serine/threonine-protein kinase MARK2 OS=Homo sapiens GN=MARK2 PE=1 SV=2 29 287 1.0E-09
sp|Q9R1U5|SIK1_RAT Serine/threonine-protein kinase SIK1 OS=Rattus norvegicus GN=Sik1 PE=1 SV=1 28 363 1.0E-09
sp|Q6P4S6|SIK3_MOUSE Serine/threonine-protein kinase SIK3 OS=Mus musculus GN=Sik3 PE=1 SV=3 26 284 1.0E-09
sp|O22932|CIPKB_ARATH CBL-interacting serine/threonine-protein kinase 11 OS=Arabidopsis thaliana GN=CIPK11 PE=1 SV=1 11 287 2.0E-09
sp|Q9C562|CIPKA_ARATH CBL-interacting serine/threonine-protein kinase 10 OS=Arabidopsis thaliana GN=CIPK10 PE=1 SV=1 29 281 2.0E-09
sp|A2KF29|SMKTR_MOUSE Sperm motility kinase Tcr mutant form OS=Mus musculus GN=Smoktcr PE=2 SV=1 26 276 3.0E-09
sp|P50528|PLO1_SCHPO Serine/threonine-protein kinase plo1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=plo1 PE=1 SV=1 23 287 3.0E-09
sp|Q626B1|PMY13_CAEBR Membrane-associated tyrosine- and threonine-specific cdc2-inhibitory kinase wee-1.3 OS=Caenorhabditis briggsae GN=wee-1.3 PE=3 SV=1 7 283 3.0E-09
sp|Q91YS8|KCC1A_MOUSE Calcium/calmodulin-dependent protein kinase type 1 OS=Mus musculus GN=Camk1 PE=1 SV=1 18 287 4.0E-09
sp|Q9IA88|SIK2_CHICK Serine/threonine-protein kinase SIK2 OS=Gallus gallus GN=SIK2 PE=2 SV=1 1 284 4.0E-09
sp|Q8VHF0|MARK3_RAT MAP/microtubule affinity-regulating kinase 3 OS=Rattus norvegicus GN=Mark3 PE=1 SV=1 29 287 5.0E-09
sp|Q63450|KCC1A_RAT Calcium/calmodulin-dependent protein kinase type 1 OS=Rattus norvegicus GN=Camk1 PE=1 SV=2 18 287 5.0E-09
sp|Q14012|KCC1A_HUMAN Calcium/calmodulin-dependent protein kinase type 1 OS=Homo sapiens GN=CAMK1 PE=1 SV=1 18 287 5.0E-09
sp|Q9QYZ3|SMK2B_MOUSE Sperm motility kinase 2B OS=Mus musculus GN=Smok2b PE=2 SV=1 30 286 5.0E-09
sp|Q9LWM4|CIPK5_ORYSJ CBL-interacting protein kinase 5 OS=Oryza sativa subsp. japonica GN=CIPK5 PE=2 SV=1 29 296 8.0E-09
sp|P57059|SIK1_HUMAN Serine/threonine-protein kinase SIK1 OS=Homo sapiens GN=SIK1 PE=1 SV=2 28 284 8.0E-09
sp|Q6C7U8|PHO85_YARLI Negative regulator of the PHO system OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=PHO85 PE=3 SV=1 20 236 8.0E-09
sp|A8WYE4|PAR1_CAEBR Serine/threonine-protein kinase par-1 OS=Caenorhabditis briggsae GN=par-1 PE=3 SV=1 29 287 8.0E-09
sp|Q9TW45|PAR1_CAEEL Serine/threonine-protein kinase par-1 OS=Caenorhabditis elegans GN=par-1 PE=1 SV=1 29 287 9.0E-09
sp|Q9FJ54|CIPKK_ARATH CBL-interacting serine/threonine-protein kinase 20 OS=Arabidopsis thaliana GN=CIPK20 PE=1 SV=1 19 320 1.0E-08
sp|Q68Y49|CIPKJ_ORYSJ CBL-interacting protein kinase 19 OS=Oryza sativa subsp. japonica GN=CIPK19 PE=1 SV=1 29 299 2.0E-08
sp|P27448|MARK3_HUMAN MAP/microtubule affinity-regulating kinase 3 OS=Homo sapiens GN=MARK3 PE=1 SV=4 29 287 2.0E-08
sp|Q03141|MARK3_MOUSE MAP/microtubule affinity-regulating kinase 3 OS=Mus musculus GN=Mark3 PE=1 SV=2 29 287 2.0E-08
sp|Q9URT9|GSK31_SCHPO Protein kinase gsk31 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gsk31 PE=1 SV=1 23 338 3.0E-08
sp|Q68UT7|HUNK_PANTR Hormonally up-regulated neu tumor-associated kinase OS=Pan troglodytes GN=HUNK PE=3 SV=1 15 293 3.0E-08
sp|Q7X996|CIPK2_ORYSJ CBL-interacting protein kinase 2 OS=Oryza sativa subsp. japonica GN=CIPK2 PE=2 SV=1 26 291 3.0E-08
sp|P57058|HUNK_HUMAN Hormonally up-regulated neu tumor-associated kinase OS=Homo sapiens GN=HUNK PE=1 SV=1 15 293 4.0E-08
sp|Q75L42|CIPKH_ORYSJ CBL-interacting protein kinase 17 OS=Oryza sativa subsp. japonica GN=CIPK17 PE=2 SV=1 20 231 4.0E-08
sp|Q75GK4|CIPK7_ORYSJ CBL-interacting protein kinase 7 OS=Oryza sativa subsp. japonica GN=CIPK7 PE=2 SV=1 26 177 4.0E-08
sp|Q0D4B2|CIPKL_ORYSJ CBL-interacting protein kinase 21 OS=Oryza sativa subsp. japonica GN=CIPK21 PE=2 SV=2 26 230 5.0E-08
sp|Q9LEU7|CIPK5_ARATH CBL-interacting serine/threonine-protein kinase 5 OS=Arabidopsis thaliana GN=CIPK5 PE=2 SV=1 26 296 5.0E-08
sp|Q2V452|CIPK3_ARATH CBL-interacting serine/threonine-protein kinase 3 OS=Arabidopsis thaliana GN=CIPK3 PE=1 SV=2 26 298 5.0E-08
sp|Q8BRK8|AAPK2_MOUSE 5'-AMP-activated protein kinase catalytic subunit alpha-2 OS=Mus musculus GN=Prkaa2 PE=1 SV=3 30 299 6.0E-08
sp|Q09137|AAPK2_RAT 5'-AMP-activated protein kinase catalytic subunit alpha-2 OS=Rattus norvegicus GN=Prkaa2 PE=1 SV=1 30 299 6.0E-08
sp|Q8BWQ5|DCLK3_MOUSE Serine/threonine-protein kinase DCLK3 OS=Mus musculus GN=Dclk3 PE=2 SV=2 31 287 7.0E-08
sp|Q9FJ55|CIPKJ_ARATH CBL-interacting serine/threonine-protein kinase 19 OS=Arabidopsis thaliana GN=CIPK19 PE=2 SV=1 26 341 7.0E-08
sp|Q6ZLP5|CIPKN_ORYSJ CBL-interacting protein kinase 23 OS=Oryza sativa subsp. japonica GN=CIPK23 PE=2 SV=1 29 298 7.0E-08
sp|P54646|AAPK2_HUMAN 5'-AMP-activated protein kinase catalytic subunit alpha-2 OS=Homo sapiens GN=PRKAA2 PE=1 SV=2 30 299 7.0E-08
sp|Q5RD00|AAPK2_PONAB 5'-AMP-activated protein kinase catalytic subunit alpha-2 OS=Pongo abelii GN=PRKAA2 PE=2 SV=1 30 299 8.0E-08
sp|Q9SN43|CIPKC_ARATH CBL-interacting serine/threonine-protein kinase 12 OS=Arabidopsis thaliana GN=CIPK12 PE=1 SV=1 31 291 8.0E-08
sp|Q9QYZ6|SMK2A_MOUSE Sperm motility kinase 2A OS=Mus musculus GN=Smok2a PE=2 SV=1 26 295 9.0E-08
sp|Q28948|AAPK2_PIG 5'-AMP-activated protein kinase catalytic subunit alpha-2 OS=Sus scrofa GN=PRKAA2 PE=2 SV=2 30 299 9.0E-08
sp|O80902|CIPKM_ARATH CBL-interacting serine/threonine-protein kinase 22 OS=Arabidopsis thaliana GN=CIPK22 PE=2 SV=1 31 226 9.0E-08
sp|Q9LGV5|CIPK1_ORYSJ CBL-interacting protein kinase 1 OS=Oryza sativa subsp. japonica GN=CIPK1 PE=2 SV=1 29 296 1.0E-07
sp|Q11179|YPC2_CAEEL Putative serine/threonine-protein kinase C05D10.2 OS=Caenorhabditis elegans GN=C05D10.2 PE=3 SV=2 81 236 1.0E-07
sp|Q5W736|CIPKI_ORYSJ CBL-interacting protein kinase 18 OS=Oryza sativa subsp. japonica GN=CIPK18 PE=2 SV=1 29 289 1.0E-07
sp|Q9NRH2|SNRK_HUMAN SNF-related serine/threonine-protein kinase OS=Homo sapiens GN=SNRK PE=1 SV=2 19 284 1.0E-07
sp|O88866|HUNK_MOUSE Hormonally up-regulated neu tumor-associated kinase OS=Mus musculus GN=Hunk PE=2 SV=1 15 293 2.0E-07
sp|Q2RAX3|CIPKX_ORYSJ CBL-interacting protein kinase 33 OS=Oryza sativa subsp. japonica GN=CIPK33 PE=2 SV=1 26 243 2.0E-07
sp|Q6NSM8|SIK3_DANRE Serine/threonine-protein kinase SIK3 homolog OS=Danio rerio GN=zgc:66101 PE=2 SV=1 11 284 3.0E-07
sp|P16892|FUS3_YEAST Mitogen-activated protein kinase FUS3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FUS3 PE=1 SV=2 24 236 3.0E-07
sp|Q8C0N0|SMKZ_MOUSE Sperm motility kinase Z OS=Mus musculus GN=Gm4922 PE=2 SV=1 77 286 3.0E-07
sp|Q9QYZ5|SMK3_MOUSE Sperm motility kinase 3 OS=Mus musculus GN=Smok3a PE=2 SV=1 77 164 3.0E-07
sp|Q8W1D5|CIPKP_ARATH CBL-interacting serine/threonine-protein kinase 25 OS=Arabidopsis thaliana GN=CIPK25 PE=2 SV=1 26 281 3.0E-07
sp|Q6ERS4|CIPKG_ORYSJ CBL-interacting protein kinase 16 OS=Oryza sativa subsp. japonica GN=CIPK16 PE=2 SV=1 26 281 3.0E-07
sp|Q6FIU2|HOG1_CANGA Mitogen-activated protein kinase HOG1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=HOG1 PE=3 SV=1 46 236 3.0E-07
sp|Q8TD08|MK15_HUMAN Mitogen-activated protein kinase 15 OS=Homo sapiens GN=MAPK15 PE=1 SV=1 29 236 4.0E-07
sp|O18209|PMY13_CAEEL Membrane-associated tyrosine- and threonine-specific cdc2-inhibitory kinase wee-1.3 OS=Caenorhabditis elegans GN=wee-1.3 PE=1 SV=1 23 287 4.0E-07
sp|Q8BHI9|NIM1_MOUSE Serine/threonine-protein kinase NIM1 OS=Mus musculus GN=Nim1k PE=2 SV=1 31 164 4.0E-07
sp|O65554|CIPK6_ARATH CBL-interacting serine/threonine-protein kinase 6 OS=Arabidopsis thaliana GN=CIPK6 PE=1 SV=1 13 287 6.0E-07
sp|Q2QMI0|CIPK4_ORYSJ CBL-interacting protein kinase 4 OS=Oryza sativa subsp. japonica GN=CIPK4 PE=2 SV=2 26 283 6.0E-07
sp|O08678|MARK1_RAT Serine/threonine-protein kinase MARK1 OS=Rattus norvegicus GN=Mark1 PE=1 SV=1 11 249 6.0E-07
sp|Q8IY84|NIM1_HUMAN Serine/threonine-protein kinase NIM1 OS=Homo sapiens GN=NIM1K PE=1 SV=1 31 295 6.0E-07
sp|Q8VHJ5|MARK1_MOUSE Serine/threonine-protein kinase MARK1 OS=Mus musculus GN=Mark1 PE=1 SV=2 11 249 6.0E-07
sp|P92937|CIPKF_ARATH CBL-interacting serine/threonine-protein kinase 15 OS=Arabidopsis thaliana GN=CIPK15 PE=1 SV=2 25 291 6.0E-07
sp|F1QGZ6|MELK_DANRE Maternal embryonic leucine zipper kinase OS=Danio rerio GN=melk PE=2 SV=1 22 287 7.0E-07
sp|Q10SC8|CIPK9_ORYSJ CBL-interacting protein kinase 9 OS=Oryza sativa subsp. japonica GN=CIPK9 PE=2 SV=1 29 298 7.0E-07
sp|Q9LDI3|CIPKO_ARATH CBL-interacting serine/threonine-protein kinase 24 OS=Arabidopsis thaliana GN=CIPK24 PE=1 SV=1 26 226 7.0E-07
sp|A1A5Q6|SMK_RAT Sperm motility kinase OS=Rattus norvegicus GN=Smok PE=2 SV=1 30 288 8.0E-07
sp|Q9SEZ7|CIPKG_ARATH CBL-interacting serine/threonine-protein kinase 16 OS=Arabidopsis thaliana GN=CIPK16 PE=1 SV=1 29 296 8.0E-07
sp|Q8LIG4|CIPK3_ORYSJ CBL-interacting protein kinase 3 OS=Oryza sativa subsp. japonica GN=CIPK3 PE=2 SV=1 26 344 9.0E-07
sp|Q9P0L2|MARK1_HUMAN Serine/threonine-protein kinase MARK1 OS=Homo sapiens GN=MARK1 PE=1 SV=2 11 249 1.0E-06
sp|Q2QY53|CIPKW_ORYSJ CBL-interacting protein kinase 32 OS=Oryza sativa subsp. japonica GN=CIPK32 PE=2 SV=2 26 243 1.0E-06
sp|P32485|HOG1_YEAST Mitogen-activated protein kinase HOG1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HOG1 PE=1 SV=2 49 236 1.0E-06
sp|Q5N942|SAPK4_ORYSJ Serine/threonine-protein kinase SAPK4 OS=Oryza sativa subsp. japonica GN=SAPK4 PE=2 SV=2 26 153 2.0E-06
sp|Q6XKY3|HOG1_HYPAT Mitogen-activated protein kinase hog1 OS=Hypocrea atroviridis GN=hog1 PE=3 SV=1 29 236 2.0E-06
sp|P22517|KCC2_YEAST Calcium/calmodulin-dependent protein kinase II OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CMK2 PE=1 SV=2 27 287 2.0E-06
sp|O93982|HOG1_ZYGRC Mitogen-activated protein kinase HOG1 OS=Zygosaccharomyces rouxii (strain ATCC 2623 / CBS 732 / NBRC 1130 / NCYC 568 / NRRL Y-229) GN=HOG1 PE=3 SV=2 49 236 2.0E-06
sp|Q1DUU8|HOG1_COCIM Mitogen-activated protein kinase HOG1 OS=Coccidioides immitis (strain RS) GN=HOG1 PE=3 SV=1 29 236 2.0E-06
sp|O59853|HOG2_ZYGRO Mitogen-activated protein kinase HOG2 OS=Zygosaccharomyces rouxii GN=HOG2 PE=3 SV=1 49 236 2.0E-06
sp|Q755C4|IPL1_ASHGO Spindle assembly checkpoint kinase OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=IPL1 PE=3 SV=1 9 164 2.0E-06
sp|Q38997|KIN10_ARATH SNF1-related protein kinase catalytic subunit alpha KIN10 OS=Arabidopsis thaliana GN=KIN10 PE=1 SV=2 22 306 3.0E-06
sp|Q76P07|Y7165_DICDI Probable serine/threonine-protein kinase DDB_G0277165 OS=Dictyostelium discoideum GN=DDB_G0277165 PE=3 SV=1 29 307 3.0E-06
sp|Q9LYQ8|CIPK2_ARATH CBL-interacting serine/threonine-protein kinase 2 OS=Arabidopsis thaliana GN=CIPK2 PE=1 SV=1 29 226 3.0E-06
sp|Q4W6D3|HOG1_COCHE Mitogen-activated protein kinase HOG1 OS=Cochliobolus heterostrophus GN=HOG1 PE=1 SV=1 29 236 3.0E-06
sp|Q2WFL5|HOG1_COCMI Mitogen-activated protein kinase HOG1 OS=Cochliobolus miyabeanus GN=HOG1 PE=3 SV=1 31 236 4.0E-06
sp|Q9MAM1|CIPK9_ARATH CBL-interacting serine/threonine-protein kinase 9 OS=Arabidopsis thaliana GN=CIPK9 PE=1 SV=2 29 298 4.0E-06
sp|Q8RWC9|CIPK1_ARATH CBL-interacting serine/threonine-protein kinase 1 OS=Arabidopsis thaliana GN=CIPK1 PE=1 SV=2 26 282 4.0E-06
sp|O59854|HOG1_ZYGRO Mitogen-activated protein kinase HOG1 OS=Zygosaccharomyces rouxii GN=HOG1 PE=3 SV=1 49 236 5.0E-06
sp|Q1L5Z8|HOG1_TORDE Mitogen-activated protein kinase HOG1 OS=Torulaspora delbrueckii GN=HOG1 PE=1 SV=1 49 236 5.0E-06
sp|Q6AXJ9|CDKL1_DANRE Cyclin-dependent kinase-like 1 OS=Danio rerio GN=cdkl1 PE=2 SV=1 26 260 5.0E-06
sp|P26696|MK01_XENLA Mitogen-activated protein kinase 1 OS=Xenopus laevis GN=mapk1 PE=1 SV=3 31 236 6.0E-06
sp|B1WAS2|HUNK_XENTR Hormonally up-regulated neu tumor-associated kinase homolog OS=Xenopus tropicalis GN=hunk PE=2 SV=1 29 286 7.0E-06
sp|Q750A9|HOG1_ASHGO Mitogen-activated protein kinase HOG1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=HOG1 PE=3 SV=2 49 236 7.0E-06
sp|Q6X4A2|CIPKV_ORYSJ CBL-interacting protein kinase 31 OS=Oryza sativa subsp. japonica GN=CIPK31 PE=1 SV=1 26 298 8.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005524 ATP binding Yes
GO:0004672 protein kinase activity Yes
GO:0005515 protein binding Yes
GO:0006468 protein phosphorylation Yes
GO:0008152 metabolic process No
GO:0032559 adenyl ribonucleotide binding No
GO:0097159 organic cyclic compound binding No
GO:0006793 phosphorus metabolic process No
GO:0071704 organic substance metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0005488 binding No
GO:1901265 nucleoside phosphate binding No
GO:0044267 cellular protein metabolic process No
GO:0044238 primary metabolic process No
GO:0044237 cellular metabolic process No
GO:0008150 biological_process No
GO:0036094 small molecule binding No
GO:0016301 kinase activity No
GO:0044260 cellular macromolecule metabolic process No
GO:0008144 drug binding No
GO:0036211 protein modification process No
GO:0016740 transferase activity No
GO:0003674 molecular_function No
GO:0016772 transferase activity, transferring phosphorus-containing groups No
GO:0032555 purine ribonucleotide binding No
GO:0016310 phosphorylation No
GO:0009987 cellular process No
GO:1901564 organonitrogen compound metabolic process No
GO:0006464 cellular protein modification process No
GO:1901363 heterocyclic compound binding No
GO:0000166 nucleotide binding No
GO:0043167 ion binding No
GO:0043168 anion binding No
GO:0097367 carbohydrate derivative binding No
GO:0003824 catalytic activity No
GO:0016773 phosphotransferase activity, alcohol group as acceptor No
GO:0019538 protein metabolic process No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0032553 ribonucleotide binding No
GO:0030554 adenyl nucleotide binding No
GO:0140096 catalytic activity, acting on a protein No
GO:0006796 phosphate-containing compound metabolic process No
GO:0043412 macromolecule modification No
GO:0017076 purine nucleotide binding No
GO:0043170 macromolecule metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 17 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|7287
MGQGFSLATPSAGSAGIDIAQLQDVQYERSIGNGRFMKSIRGRHENGVVLVKVLVKPFAEVNLDEYKQQIIKQRK
AMADVPNALAFQRIIETETNGYLVRQFQYSSLYDRLSTRPFLEDIEKKWLAFQLLCALRDCHARDVYHGDIKAQN
VLVTSWNWLYLTDFSSPYKPVLLPDDNPGDFSYFFDTSGRRTCYIAPERFYAAGSHPPPKARMTWAMDIFSAGCV
IAQMFLESELFSLAQLYKYRRGEYDPVFAHLSVISDKDVREMIAHMIQLNPEKRYSADQYLEFWKGKVFPPYFYN
FLHQYMELITDPSSGINPMSGSQKNMGESDDRIDRVFNDFDKVSYFLGYQPEKRLASATALSPARLALGHFPVRL
SIANHELPVSADLEPPEDDGTLIFLTLIVSSIRTTARASSRVRACDLLLAFAERLTDEAKLDRVLPYLMMLLRWE
EADRVIVSAIRTITQLLQLVRMPTPINSHVLVEYVLPRMEVALGTRVRTPSPLVRATYASCIGSLASTGQRFLEI
ASSLRADGSMPIADPEVEPGADAEANFESVFDTAGRELFETLESHTKQLVEDPDVHVRRAFLASVPELCMFFQEH
SNDILLTHLNTYLNDRDWTLKCAFFDTVVGIAAFIGSTSLEEFILPLMVQALADTEEFVVQAALHAIAQLAGLGL
LSRSKIWELADLVGRLTVHPNLWIREAAVEFLAMSAKFLAPSDVRCILMPLMKPYLKVATLVDVSELDILNCLKR
PLPRAVFDQAVTWATQTDRGVFWKPLQRVRSLTLGSPGGLPARSSKDLDAQSLSKVARNDEDEQWLEKLRNFGLR
AEDEIKLLALREYIWRMSKARSRDSPAGEGSVPTGFVALKALGVTPQTVFFNDAPLRDSSIEPDLSSPPGPYTIA
EALLDASMTLGDSVSRRRQAALNSHANRVRSVGPRPSQTARRRLSPEGSGRAGSRPSRGESPLNRGSGAGDDELS
VRDGPYSARRSVRHQASALSLLDRSDGNKSAAETGTSDANAFGEVEGFYAQATPSSPATVRDSDERRASSKQSRH
SYEGTDPNIQRMLDRMYIDNFPRDVLEFGPMVTPIWGGKLRIVNAHAGASQWRPGGHLVATFAEHKGPVNRVVAS
PDHVFFVTGGTDGTARIWDTARLERNISHRSRQMHKHAEGARVSALCFVENTHCFVSCGSDGSVHVVKVDTVSVS
GVVRYGKLRLVREHQLPEGESAVWCEHFKQESASVLILATNRSRILGIDLRSMSVLYELENPVHHGTPTCLCVDR
KRNWICVGTSHGVIDLWDLRFKMRLKGWGVPGKASIYRMCIHPTKGRGKWICVTGGTGQGEVTVWDLEKTTCREI
YRTCGNRDGPKAYSPWDVDEDRPEGMLGRFATNLESSDPANGDRGVRAMVVGTGSAEDSRDVRHAYMATGGSDKK
LRFWDMSRIENSCTYSGVQPDEPGPTYAATNPVAGLTLNTERTSRHGGSGGSNDGAGTRYKSVASGRPPRSTVIS
MQQQQLLQSHLDAILDLMILEYPYTMSVSVDRSGAVFVFQ*
Coding >Hirsu2|7287
ATGGGTCAAGGATTCTCGCTCGCGACGCCGTCTGCCGGCTCGGCCGGCATAGACATTGCTCAGCTCCAGGACGTC
CAGTACGAGAGGAGCATCGGGAACGGCCGATTCATGAAGAGCATCCGCGGCCGCCACGAAAACGGTGTCGTCCTT
GTCAAGGTCCTCGTCAAGCCCTTTGCCGAGGTCAACCTCGACGAATACAAGCAGCAGATCATCAAGCAGCGCAAG
GCCATGGCCGACGTCCCCAACGCCCTCGCCTTCCAGCGTATCATCGAAACCGAGACCAACGGCTACCTCGTGCGC
CAGTTTCAGTACAGCTCCCTTTACGACCGACTGAGCACCCGGCCCTTCCTGGAAGACATTGAGAAAAAATGGCTC
GCGTTTCAGCTGCTGTGCGCCTTGCGGGACTGCCACGCTCGAGATGTCTACCACGGCGACATCAAGGCCCAGAAC
GTCCTCGTGACCTCTTGGAACTGGCTCTACCTTACCGACTTCTCGTCACCCTACAAGCCGGTTCTGTTACCCGAC
GACAACCCCGGCGACTTCTCCTACTTCTTCGACACCTCCGGGAGGCGCACCTGCTACATTGCCCCCGAGCGCTTC
TATGCGGCGGGTTCTCACCCGCCGCCAAAGGCCCGGATGACTTGGGCCATGGACATCTTCAGCGCCGGATGCGTC
ATTGCGCAAATGTTCCTCGAGTCCGAGCTGTTCAGCCTCGCCCAGCTGTACAAGTATCGCCGCGGCGAGTACGAC
CCAGTGTTCGCCCATCTGAGCGTCATATCAGACAAGGACGTCCGCGAGATGATTGCCCACATGATTCAGCTGAAT
CCAGAGAAGCGCTACTCGGCGGACCAGTATCTCGAGTTCTGGAAGGGGAAGGTCTTCCCGCCCTACTTCTACAAT
TTCCTGCACCAGTACATGGAACTCATCACCGACCCGTCCTCCGGCATCAACCCAATGTCCGGGTCGCAGAAGAAC
ATGGGGGAGTCTGATGACCGCATAGACCGCGTCTTCAATGACTTTGACAAGGTCTCTTACTTCCTCGGCTACCAG
CCTGAAAAACGGTTGGCGTCGGCAACGGCGCTGTCGCCTGCACGTCTCGCCCTCGGCCACTTCCCCGTCCGCCTG
AGCATCGCAAACCACGAGCTGCCCGTCTCCGCCGATCTCGAGCCGCCAGAAGACGACGGCACCCTCATCTTCCTC
ACCTTGATCGTGTCCTCCATCAGGACCACGGCCCGAGCCTCCTCGAGAGTGCGGGCCTGCGACCTCCTGCTGGCT
TTCGCTGAGAGGCTCACCGACGAGGCCAAGCTGGACAGGGTCTTACCTTACCTCATGATGCTGCTACGATGGGAG
GAAGCTGATAGGGTCATTGTATCCGCAATCCGCACCATCACCCAACTTCTGCAGCTCGTCCGCATGCCGACCCCA
ATCAACTCGCACGTGCTGGTGGAATACGTCTTGCCGCGGATGGAAGTCGCATTGGGTACGAGGGTGCGAACGCCA
AGCCCGCTAGTTAGAGCGACGTACGCCTCATGCATCGGAAGTCTGGCCTCGACCGGCCAGCGCTTCCTGGAGATA
GCTTCCAGTCTGAGGGCAGACGGCTCCATGCCCATCGCGGACCCGGAGGTGGAGCCTGGGGCTGATGCCGAGGCA
AACTTCGAGAGCGTCTTCGACACCGCCGGCAGGGAACTGTTCGAGACCCTGGAGAGCCATACCAAGCAGCTGGTG
GAGGACCCAGACGTCCACGTCCGCCGTGCTTTCTTGGCTTCGGTGCCGGAACTCTGCATGTTCTTCCAGGAGCAT
TCCAACGACATCCTGCTGACGCATCTAAACACGTACCTCAACGACCGCGACTGGACCCTCAAGTGCGCCTTCTTC
GACACCGTCGTCGGCATCGCGGCCTTCATCGGGAGCACCAGCCTGGAGGAGTTCATACTTCCACTCATGGTCCAA
GCCCTGGCGGATACCGAGGAATTTGTCGTGCAGGCTGCGCTGCATGCCATCGCGCAGCTCGCCGGCCTGGGCCTC
CTGTCGAGGTCCAAGATATGGGAGCTGGCAGATCTCGTGGGCAGGCTGACAGTGCACCCCAATTTGTGGATACGG
GAAGCCGCGGTAGAGTTTCTAGCCATGTCCGCCAAGTTCCTGGCCCCGTCGGATGTCCGGTGTATTTTGATGCCC
CTGATGAAGCCGTATCTCAAAGTTGCGACGCTTGTCGATGTTTCCGAGCTGGACATTCTCAACTGTCTGAAGAGG
CCTCTCCCTCGCGCCGTGTTTGATCAAGCTGTCACCTGGGCCACGCAGACGGATCGTGGCGTGTTCTGGAAGCCC
CTCCAACGGGTGCGATCACTGACCCTCGGATCACCGGGGGGGCTGCCGGCCCGATCATCAAAAGACTTGGACGCC
CAGTCGCTGAGCAAAGTCGCCCGCAACGACGAGGATGAGCAGTGGCTCGAAAAGCTGCGAAATTTCGGCCTCAGG
GCAGAGGATGAGATAAAGCTCTTGGCCCTTCGAGAGTACATCTGGCGCATGAGCAAGGCCAGGTCGCGAGACTCC
CCGGCCGGAGAGGGTAGCGTACCGACCGGTTTCGTGGCCCTCAAAGCCCTGGGCGTGACGCCCCAGACGGTGTTC
TTCAACGACGCGCCCCTCCGGGACTCATCGATAGAACCGGACCTCAGCTCTCCGCCGGGCCCTTACACCATCGCA
GAGGCGCTTCTGGACGCCTCGATGACCCTCGGCGACTCGGTCAGCAGGAGGAGGCAGGCGGCTCTGAACAGTCAC
GCCAACAGAGTCCGCAGCGTCGGCCCGCGGCCGTCGCAGACGGCAAGACGGCGTTTATCGCCCGAAGGCAGCGGG
AGGGCCGGCTCAAGACCGTCGAGAGGAGAGTCGCCCCTCAACCGCGGCAGTGGAGCGGGCGACGACGAACTGTCT
GTCAGAGACGGCCCCTACTCGGCGAGACGGAGCGTGCGACACCAGGCGAGTGCGCTGAGCCTTCTCGATCGTAGC
GACGGCAACAAGTCGGCGGCGGAGACCGGCACCAGCGACGCCAACGCCTTCGGAGAGGTCGAGGGGTTCTATGCC
CAGGCGACGCCCTCGTCGCCGGCTACGGTCCGAGACAGCGACGAGCGCAGGGCCAGTTCGAAGCAGTCGAGGCAC
AGCTATGAGGGGACCGATCCAAACATACAGAGGATGCTGGACAGGATGTACATCGACAACTTCCCCCGCGACGTC
CTTGAGTTCGGGCCCATGGTGACGCCCATCTGGGGCGGCAAGCTCCGGATCGTCAACGCCCATGCGGGGGCATCC
CAATGGAGACCTGGGGGGCACCTCGTGGCGACGTTCGCGGAGCACAAAGGCCCCGTCAATAGAGTGGTCGCATCC
CCCGACCACGTTTTCTTCGTTACCGGCGGCACCGACGGCACCGCCCGGATCTGGGACACGGCGCGGCTGGAGCGG
AATATCAGCCACCGTTCCAGACAGATGCACAAGCACGCCGAGGGTGCCCGCGTCTCGGCCCTGTGTTTCGTCGAG
AACACGCACTGCTTCGTGAGCTGCGGGAGCGACGGGAGCGTCCACGTCGTCAAGGTCGACACGGTTTCCGTCAGC
GGCGTCGTTAGATACGGCAAACTGCGGCTGGTGCGGGAACACCAGCTGCCGGAAGGCGAGTCGGCGGTCTGGTGC
GAGCACTTCAAGCAGGAGTCGGCATCGGTGCTCATCCTCGCGACCAATCGATCGCGGATATTGGGCATTGATCTC
AGGAGTATGTCGGTGCTCTATGAGCTGGAGAATCCGGTCCACCACGGCACTCCGACCTGTCTGTGCGTGGACAGG
AAGCGGAACTGGATCTGCGTGGGGACGTCGCACGGCGTCATCGACCTCTGGGATCTGCGGTTCAAGATGAGGCTG
AAGGGCTGGGGCGTGCCGGGCAAGGCCTCGATCTATCGGATGTGCATCCACCCGACCAAAGGCCGCGGCAAATGG
ATATGCGTGACGGGCGGGACAGGACAAGGCGAGGTGACGGTCTGGGACCTGGAGAAAACGACTTGCCGAGAGATC
TACCGCACCTGCGGGAACAGGGACGGCCCCAAGGCCTACAGCCCCTGGGACGTGGACGAGGACAGGCCAGAGGGC
ATGCTGGGGCGCTTCGCCACCAACCTCGAGAGCAGCGATCCGGCCAACGGGGACCGGGGCGTGCGCGCAATGGTC
GTCGGGACCGGGTCGGCCGAGGACTCCCGGGACGTCCGTCACGCCTACATGGCGACGGGAGGCTCAGACAAGAAG
CTCCGCTTCTGGGACATGTCCCGGATCGAAAACTCGTGCACCTACAGCGGGGTGCAGCCAGACGAGCCGGGTCCG
ACCTATGCCGCCACTAACCCGGTAGCGGGCCTCACCCTCAACACCGAAAGGACGAGTCGCCACGGGGGGTCGGGG
GGGAGCAACGACGGCGCCGGGACGAGGTACAAGAGCGTGGCGAGCGGACGGCCGCCGCGGTCGACCGTCATCTCC
ATGCAGCAGCAGCAGCTGCTCCAGTCGCACCTGGACGCTATCCTTGACCTGATGATACTGGAATATCCATACACC
ATGAGCGTGTCTGTAGACCGCTCTGGAGCCGTCTTTGTGTTTCAGTAG
Transcript >Hirsu2|7287
ATGGGTCAAGGATTCTCGCTCGCGACGCCGTCTGCCGGCTCGGCCGGCATAGACATTGCTCAGCTCCAGGACGTC
CAGTACGAGAGGAGCATCGGGAACGGCCGATTCATGAAGAGCATCCGCGGCCGCCACGAAAACGGTGTCGTCCTT
GTCAAGGTCCTCGTCAAGCCCTTTGCCGAGGTCAACCTCGACGAATACAAGCAGCAGATCATCAAGCAGCGCAAG
GCCATGGCCGACGTCCCCAACGCCCTCGCCTTCCAGCGTATCATCGAAACCGAGACCAACGGCTACCTCGTGCGC
CAGTTTCAGTACAGCTCCCTTTACGACCGACTGAGCACCCGGCCCTTCCTGGAAGACATTGAGAAAAAATGGCTC
GCGTTTCAGCTGCTGTGCGCCTTGCGGGACTGCCACGCTCGAGATGTCTACCACGGCGACATCAAGGCCCAGAAC
GTCCTCGTGACCTCTTGGAACTGGCTCTACCTTACCGACTTCTCGTCACCCTACAAGCCGGTTCTGTTACCCGAC
GACAACCCCGGCGACTTCTCCTACTTCTTCGACACCTCCGGGAGGCGCACCTGCTACATTGCCCCCGAGCGCTTC
TATGCGGCGGGTTCTCACCCGCCGCCAAAGGCCCGGATGACTTGGGCCATGGACATCTTCAGCGCCGGATGCGTC
ATTGCGCAAATGTTCCTCGAGTCCGAGCTGTTCAGCCTCGCCCAGCTGTACAAGTATCGCCGCGGCGAGTACGAC
CCAGTGTTCGCCCATCTGAGCGTCATATCAGACAAGGACGTCCGCGAGATGATTGCCCACATGATTCAGCTGAAT
CCAGAGAAGCGCTACTCGGCGGACCAGTATCTCGAGTTCTGGAAGGGGAAGGTCTTCCCGCCCTACTTCTACAAT
TTCCTGCACCAGTACATGGAACTCATCACCGACCCGTCCTCCGGCATCAACCCAATGTCCGGGTCGCAGAAGAAC
ATGGGGGAGTCTGATGACCGCATAGACCGCGTCTTCAATGACTTTGACAAGGTCTCTTACTTCCTCGGCTACCAG
CCTGAAAAACGGTTGGCGTCGGCAACGGCGCTGTCGCCTGCACGTCTCGCCCTCGGCCACTTCCCCGTCCGCCTG
AGCATCGCAAACCACGAGCTGCCCGTCTCCGCCGATCTCGAGCCGCCAGAAGACGACGGCACCCTCATCTTCCTC
ACCTTGATCGTGTCCTCCATCAGGACCACGGCCCGAGCCTCCTCGAGAGTGCGGGCCTGCGACCTCCTGCTGGCT
TTCGCTGAGAGGCTCACCGACGAGGCCAAGCTGGACAGGGTCTTACCTTACCTCATGATGCTGCTACGATGGGAG
GAAGCTGATAGGGTCATTGTATCCGCAATCCGCACCATCACCCAACTTCTGCAGCTCGTCCGCATGCCGACCCCA
ATCAACTCGCACGTGCTGGTGGAATACGTCTTGCCGCGGATGGAAGTCGCATTGGGTACGAGGGTGCGAACGCCA
AGCCCGCTAGTTAGAGCGACGTACGCCTCATGCATCGGAAGTCTGGCCTCGACCGGCCAGCGCTTCCTGGAGATA
GCTTCCAGTCTGAGGGCAGACGGCTCCATGCCCATCGCGGACCCGGAGGTGGAGCCTGGGGCTGATGCCGAGGCA
AACTTCGAGAGCGTCTTCGACACCGCCGGCAGGGAACTGTTCGAGACCCTGGAGAGCCATACCAAGCAGCTGGTG
GAGGACCCAGACGTCCACGTCCGCCGTGCTTTCTTGGCTTCGGTGCCGGAACTCTGCATGTTCTTCCAGGAGCAT
TCCAACGACATCCTGCTGACGCATCTAAACACGTACCTCAACGACCGCGACTGGACCCTCAAGTGCGCCTTCTTC
GACACCGTCGTCGGCATCGCGGCCTTCATCGGGAGCACCAGCCTGGAGGAGTTCATACTTCCACTCATGGTCCAA
GCCCTGGCGGATACCGAGGAATTTGTCGTGCAGGCTGCGCTGCATGCCATCGCGCAGCTCGCCGGCCTGGGCCTC
CTGTCGAGGTCCAAGATATGGGAGCTGGCAGATCTCGTGGGCAGGCTGACAGTGCACCCCAATTTGTGGATACGG
GAAGCCGCGGTAGAGTTTCTAGCCATGTCCGCCAAGTTCCTGGCCCCGTCGGATGTCCGGTGTATTTTGATGCCC
CTGATGAAGCCGTATCTCAAAGTTGCGACGCTTGTCGATGTTTCCGAGCTGGACATTCTCAACTGTCTGAAGAGG
CCTCTCCCTCGCGCCGTGTTTGATCAAGCTGTCACCTGGGCCACGCAGACGGATCGTGGCGTGTTCTGGAAGCCC
CTCCAACGGGTGCGATCACTGACCCTCGGATCACCGGGGGGGCTGCCGGCCCGATCATCAAAAGACTTGGACGCC
CAGTCGCTGAGCAAAGTCGCCCGCAACGACGAGGATGAGCAGTGGCTCGAAAAGCTGCGAAATTTCGGCCTCAGG
GCAGAGGATGAGATAAAGCTCTTGGCCCTTCGAGAGTACATCTGGCGCATGAGCAAGGCCAGGTCGCGAGACTCC
CCGGCCGGAGAGGGTAGCGTACCGACCGGTTTCGTGGCCCTCAAAGCCCTGGGCGTGACGCCCCAGACGGTGTTC
TTCAACGACGCGCCCCTCCGGGACTCATCGATAGAACCGGACCTCAGCTCTCCGCCGGGCCCTTACACCATCGCA
GAGGCGCTTCTGGACGCCTCGATGACCCTCGGCGACTCGGTCAGCAGGAGGAGGCAGGCGGCTCTGAACAGTCAC
GCCAACAGAGTCCGCAGCGTCGGCCCGCGGCCGTCGCAGACGGCAAGACGGCGTTTATCGCCCGAAGGCAGCGGG
AGGGCCGGCTCAAGACCGTCGAGAGGAGAGTCGCCCCTCAACCGCGGCAGTGGAGCGGGCGACGACGAACTGTCT
GTCAGAGACGGCCCCTACTCGGCGAGACGGAGCGTGCGACACCAGGCGAGTGCGCTGAGCCTTCTCGATCGTAGC
GACGGCAACAAGTCGGCGGCGGAGACCGGCACCAGCGACGCCAACGCCTTCGGAGAGGTCGAGGGGTTCTATGCC
CAGGCGACGCCCTCGTCGCCGGCTACGGTCCGAGACAGCGACGAGCGCAGGGCCAGTTCGAAGCAGTCGAGGCAC
AGCTATGAGGGGACCGATCCAAACATACAGAGGATGCTGGACAGGATGTACATCGACAACTTCCCCCGCGACGTC
CTTGAGTTCGGGCCCATGGTGACGCCCATCTGGGGCGGCAAGCTCCGGATCGTCAACGCCCATGCGGGGGCATCC
CAATGGAGACCTGGGGGGCACCTCGTGGCGACGTTCGCGGAGCACAAAGGCCCCGTCAATAGAGTGGTCGCATCC
CCCGACCACGTTTTCTTCGTTACCGGCGGCACCGACGGCACCGCCCGGATCTGGGACACGGCGCGGCTGGAGCGG
AATATCAGCCACCGTTCCAGACAGATGCACAAGCACGCCGAGGGTGCCCGCGTCTCGGCCCTGTGTTTCGTCGAG
AACACGCACTGCTTCGTGAGCTGCGGGAGCGACGGGAGCGTCCACGTCGTCAAGGTCGACACGGTTTCCGTCAGC
GGCGTCGTTAGATACGGCAAACTGCGGCTGGTGCGGGAACACCAGCTGCCGGAAGGCGAGTCGGCGGTCTGGTGC
GAGCACTTCAAGCAGGAGTCGGCATCGGTGCTCATCCTCGCGACCAATCGATCGCGGATATTGGGCATTGATCTC
AGGAGTATGTCGGTGCTCTATGAGCTGGAGAATCCGGTCCACCACGGCACTCCGACCTGTCTGTGCGTGGACAGG
AAGCGGAACTGGATCTGCGTGGGGACGTCGCACGGCGTCATCGACCTCTGGGATCTGCGGTTCAAGATGAGGCTG
AAGGGCTGGGGCGTGCCGGGCAAGGCCTCGATCTATCGGATGTGCATCCACCCGACCAAAGGCCGCGGCAAATGG
ATATGCGTGACGGGCGGGACAGGACAAGGCGAGGTGACGGTCTGGGACCTGGAGAAAACGACTTGCCGAGAGATC
TACCGCACCTGCGGGAACAGGGACGGCCCCAAGGCCTACAGCCCCTGGGACGTGGACGAGGACAGGCCAGAGGGC
ATGCTGGGGCGCTTCGCCACCAACCTCGAGAGCAGCGATCCGGCCAACGGGGACCGGGGCGTGCGCGCAATGGTC
GTCGGGACCGGGTCGGCCGAGGACTCCCGGGACGTCCGTCACGCCTACATGGCGACGGGAGGCTCAGACAAGAAG
CTCCGCTTCTGGGACATGTCCCGGATCGAAAACTCGTGCACCTACAGCGGGGTGCAGCCAGACGAGCCGGGTCCG
ACCTATGCCGCCACTAACCCGGTAGCGGGCCTCACCCTCAACACCGAAAGGACGAGTCGCCACGGGGGGTCGGGG
GGGAGCAACGACGGCGCCGGGACGAGGTACAAGAGCGTGGCGAGCGGACGGCCGCCGCGGTCGACCGTCATCTCC
ATGCAGCAGCAGCAGCTGCTCCAGTCGCACCTGGACGCTATCCTTGACCTGATGATACTGGAATATCCATACACC
ATGAGCGTGTCTGTAGACCGCTCTGGAGCCGTCTTTGTGTTTCAGTAG
Gene >Hirsu2|7287
ATGGGTCAAGGATTCTCGCTCGCGACGCCGTCTGCCGGCTCGGCCGGCATAGACATTGCTCAGCTCCAGGACGTC
CAGTACGAGAGGAGCATCGGGAACGGCCGATTCATGAAGAGCATCCGCGGCCGCCACGAAAACGGTGTCGTCCTT
GTCAAGGTCCTCGTCAAGCCCTTTGCCGAGGTCAACCTCGACGAATACAAGCAGCAGATCATCAGTGGGTGCAGC
CATCGGCACATATTCCTCGCCAGACCGTCGCATCTGCTGACGAGCTGCCCTCAGAGCAGCGCAAGGCCATGGCCG
ACGTCCCCAACGCCCTCGCCTTCCAGCGTATCATCGAAACCGAGACCAACGGCTACCTCGTGCGCCAGTTTCAGT
ACAGCTCCCTTTACGACCGACTGAGCACCCGGCCCTTCCTGGAAGACATTGAGAAAAAATGGCTCGCGTTTCAGC
TGCTGTGCGCCTTGCGGGACTGCCACGCTCGAGATGTCTACCACGGCGACATCAAGGCCCAGAACGTCCTCGTGA
CCTCTTGGAACTGGCTCTACCTTACCGACTTCTCGTCACCCTACAAGCCGGTTCTGTTACCCGACGACAACCCCG
GCGACTTCTCCTACTTCTTCGACACCTCCGGGAGGCGCACCTGCTACATTGCCCCCGAGCGCTTCTATGCGGCGG
GTTCTCACCCGCCGCCAAAGGCCCGGATGACTTGGGCCATGGACATCTTCAGCGCCGGATGCGTCATTGCGCAAA
TGTTCCTCGAGTCCGAGCTGTTCAGCCTCGCCCAGCTGTACAAGTATCGCCGCGGCGAGTACGACCCAGTGTTCG
CCCATCTGAGCGTCATATCAGACAAGGACGTCCGCGAGATGATTGCCCACATGATTCAGCTGAATCCAGAGAAGC
GCTACTCGGCGGACCAGTATCTCGAGTTCTGGAAGGGGAAGGTCTTCCCGCCCTACTTCTACAATTTCCTGCACC
AGTACATGGAACTCATCACCGACCCGTCCTCCGGCATCAACCCAATGTCCGGGTCGCAGAAGAACATGGGGGAGT
CTGATGACCGCATAGACCGCGTCTTCAATGACTTTGACAAGGTCTCTTACTTCCTCGGCTACCAGCCTGAAAAAC
GGTTGGCGTCGGCAACGGCGCTGTCGCCTGCACGTCTCGCCCTCGGCCACTTCCCCGTCCGCCTGAGCATCGCAA
ACCACGAGCTGCCCGTCTCCGCCGATCTCGAGCCGCCAGAAGACGACGGCACCCTCATCTTCCTCACCTTGATCG
TGTCCTCCATCAGGACCACGGCCCGAGCCTCCTCGAGAGTGCGGGCCTGCGACCTCCTGCTGGCTTTCGCTGAGA
GGCTCACCGACGAGGCCAAGCTGGACAGGGTCTTACCTTACCTCATGATGCTGCTACGATGGGAGGAAGCTGATA
GGGTCATTGTATCCGCAATCCGCACCATCACCCAACTTCTGCAGCTCGTCCGCATGCCGACCCCAATCAACTCGC
ACGTGCTGGTGGAATACGTCTTGCCGCGGATGGAAGTCGCATTGGGTACGAGGGTGCGAACGCCAAGCCCGCTAG
TTAGAGCGACGTACGCCTCATGCATCGGAAGTCTGGCCTCGACCGGCCAGCGCTTCCTGGAGATAGCTTCCAGTC
TGAGGGCAGACGGCTCCATGCCCATCGCGGACCCGGAGGTGGAGCCTGGGGCTGATGCCGAGGCAAACTTCGAGA
GCGTCTTCGACACCGCCGGCAGGGAACTGTTCGAGACCCTGGAGAGCCATACCAAGCAGCTGGTGGAGGACCCAG
ACGTCCACGTCCGCCGTGCTTTCTTGGCTTCGGTGCCGGAACTCTGCATGTTCTTCCAGGAGCATTCCAACGACA
TCCTGCTGACGCATCTAAACACGTACCTCAACGACCGCGACTGGACCCTCAAGTGCGCCTTCTTCGACACCGTCG
TCGGCATCGCGGCCTTCATCGGGAGCACCAGCCTGGAGGAGTTCATACTTCCACTCATGGTCCAAGCCCTGGCGG
ATACCGAGGAATTTGTCGTGCAGGCTGCGCTGCATGCCATCGCGCAGCTCGCCGGCCTGGGCCTCCTGTCGAGGT
CCAAGATATGGGAGCTGGCAGATCTCGTGGGCAGGCTGACAGTGCACCCCAATTTGTGGATACGGGAAGCCGCGG
TAGAGTTTCTAGCCATGTCCGCCAAGTTCCTGGCCCCGTCGGATGTCCGGTGTATTTTGATGCCCCTGATGAAGC
CGTATCTCAAAGTTGCGACGCTTGTCGATGTTTCCGAGCTGGACATTCTCAACTGTCTGAAGAGGCCTCTCCCTC
GCGCCGTGTTTGATCAAGCTGTCACCTGGGCCACGCAGACGGATCGTGGCGTGTTCTGGAAGCCCCTCCAACGGG
TGCGATCACTGACCCTCGGATCACCGGGGGGGCTGCCGGCCCGATCATCAAAAGACTTGGACGCCCAGTCGCTGA
GCAAAGTCGCCCGCAACGACGAGGATGAGCAGTGGCTCGAAAAGCTGCGAAATTTCGGCCTCAGGGCAGAGGATG
AGATAAAGCTCTTGGCCCTTCGAGAGTACATCTGGCGCATGAGCAAGGCCAGGTCGCGAGACTCCCCGGCCGGAG
AGGGTAGCGTACCGACCGGTTTCGTGGCCCTCAAAGCCCTGGGCGTGACGCCCCAGACGGTGTTCTTCAACGACG
CGCCCCTCCGGGACTCATCGATAGAACCGGACCTCAGCTCTCCGCCGGGCCCTTACACCATCGCAGAGGCGCTTC
TGGACGCCTCGATGACCCTCGGCGACTCGGTCAGCAGGAGGAGGCAGGCGGCTCTGAACAGTCACGCCAACAGAG
TCCGCAGCGTCGGCCCGCGGCCGTCGCAGACGGCAAGACGGCGTTTATCGCCCGAAGGCAGCGGGAGGGCCGGCT
CAAGACCGTCGAGAGGAGAGTCGCCCCTCAACCGCGGCAGTGGAGCGGGCGACGACGAACTGTCTGTCAGAGACG
GCCCCTACTCGGCGAGACGGAGCGTGCGACACCAGGCGAGTGCGCTGAGCCTTCTCGATCGTAGCGACGGCAACA
AGTCGGCGGCGGAGACCGGCACCAGCGACGCCAACGCCTTCGGAGAGGTCGAGGGGTTCTATGCCCAGGCGACGC
CCTCGTCGCCGGCTACGGTCCGAGACAGCGACGAGCGCAGGGCCAGTTCGAAGCAGTCGAGGCACAGCTATGAGG
GGACCGATCCAAACATACAGAGGATGCTGGACAGGATGTACATCGACAACTTCCCCCGCGACGTCCTTGAGTTCG
GGCCCATGGTGACGCCCATCTGGGGCGGCAAGCTCCGGATCGTCAACGCCCATGCGGGGGCATCCCAATGGAGAC
CTGGGGGGCACCTCGTGGCGACGTTCGCGGAGCACAAAGGCCCCGTCAATAGAGTGGTCGCATCCCCCGACCACG
TTTTCTTCGTTACCGGCGGCACCGACGGCACCGCCCGGATCTGGGACACGGCGCGGCTGGAGCGGAATATCAGCC
ACCGTTCCAGACAGATGCACAAGCACGCCGAGGGTGCCCGCGTCTCGGCCCTGTGTTTCGTCGAGAACACGCACT
GCTTCGTGAGCTGCGGGAGCGACGGGAGCGTCCACGTCGTCAAGGTCGACACGGTTTCCGTCAGCGGCGTCGTTA
GATACGGCAAACTGCGGCTGGTGCGGGAACACCAGCTGCCGGAAGGCGAGTCGGCGGTCTGGTGCGAGCACTTCA
AGCAGGAGTCGGCATCGGTGCTCATCCTCGCGACCAATCGATCGCGGATATTGGGCATTGATCTCAGGAGTATGT
CGGTGCTCTATGAGCTGGAGAATCCGGTCCACCACGGCACTCCGACCTGTCTGTGCGTGGACAGGAAGCGGAACT
GGATCTGCGTGGGGACGTCGCACGGCGTCATCGACCTCTGGGATCTGCGGTTCAAGATGAGGCTGAAGGGCTGGG
GCGTGCCGGGCAAGGCCTCGATCTATCGGATGTGCATCCACCCGACCAAAGGCCGCGGCAAATGGATATGCGTGA
CGGGCGGGACAGGACAAGGCGAGGTGACGGTCTGGGACCTGGAGAAAACGACTTGCCGAGAGATCTACCGCACCT
GCGGGAACAGGGACGGCCCCAAGGCCTACAGCCCCTGGGACGTGGACGAGGACAGGCCAGAGGGCATGCTGGGGC
GCTTCGCCACCAACCTCGAGAGCAGCGATCCGGCCAACGGGGACCGGGGCGTGCGCGCAATGGTCGTCGGGACCG
GGTCGGCCGAGGACTCCCGGGACGTCCGTCACGCCTACATGGCGACGGGAGGCTCAGACAAGAAGCTCCGCTTCT
GGGACATGTCCCGGATCGAAAACTCGTGCACCTACAGCGGGGTGCAGCCAGACGAGCCGGGTCCGACCTATGCCG
CCACTAACCCGGTAGCGGGCCTCACCCTCAACACCGAAAGGACGAGTCGCCACGGGGGGTCGGGGGGGAGCAACG
ACGGCGCCGGGACGAGGTACAAGAGCGTGGCGAGCGGACGGCCGCCGCGGTCGACCGTCATCTCCATGCAGCAGC
AGCAGCTGCTCCAGTCGCACCTGGACGCTATCCTTGACCTGATGATACTGGAATATCCATACACCATGAGCGTGT
CTGTAGACCGCTCTGGAGCCGTCTTTGTGTTTCAGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail