Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|7280
Gene name
LocationContig_413:1084..2108
Strand+
Gene length (bp)1024
Transcript length (bp)966
Coding sequence length (bp)966
Protein length (aa) 322

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00303 Thymidylat_synt Thymidylate synthase 1.4E-107 5 321

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P13100|TYSY_PNECA Thymidylate synthase OS=Pneumocystis carinii GN=THYA PE=1 SV=1 3 321 2.0E-139
sp|P12461|TYSY_CANAL Thymidylate synthase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=TMP1 PE=3 SV=3 4 321 1.0E-138
sp|P0CS12|TYSY_CRYNJ Thymidylate synthase OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=TMP1 PE=1 SV=1 3 321 4.0E-134
sp|P0CS13|TYSY_CRYNB Thymidylate synthase OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=TMP1 PE=3 SV=1 3 321 4.0E-134
sp|P06785|TYSY_YEAST Thymidylate synthase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CDC21 PE=1 SV=1 2 321 8.0E-134
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P13100|TYSY_PNECA Thymidylate synthase OS=Pneumocystis carinii GN=THYA PE=1 SV=1 3 321 2.0E-139
sp|P12461|TYSY_CANAL Thymidylate synthase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=TMP1 PE=3 SV=3 4 321 1.0E-138
sp|P0CS12|TYSY_CRYNJ Thymidylate synthase OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=TMP1 PE=1 SV=1 3 321 4.0E-134
sp|P0CS13|TYSY_CRYNB Thymidylate synthase OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=TMP1 PE=3 SV=1 3 321 4.0E-134
sp|P06785|TYSY_YEAST Thymidylate synthase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CDC21 PE=1 SV=1 2 321 8.0E-134
sp|Q9UTI7|TYSY_SCHPO Probable thymidylate synthase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC15E1.04 PE=3 SV=1 3 321 8.0E-129
sp|Q9P4T7|TYSY_AGABI Thymidylate synthase OS=Agaricus bisporus GN=tms1 PE=3 SV=1 1 321 1.0E-127
sp|O81395|DRTS_MAIZE Bifunctional dihydrofolate reductase-thymidylate synthase OS=Zea mays GN=DRTS PE=2 SV=1 3 321 4.0E-124
sp|Q05763|DRTS2_ARATH Bifunctional dihydrofolate reductase-thymidylate synthase 2 OS=Arabidopsis thaliana GN=THY-2 PE=2 SV=2 3 321 4.0E-123
sp|Q89940|TYSY_EHV2 Thymidylate synthase OS=Equine herpesvirus 2 (strain 86/87) GN=70 PE=3 SV=1 4 321 2.0E-121
sp|Q05762|DRTS1_ARATH Bifunctional dihydrofolate reductase-thymidylate synthase 1 OS=Arabidopsis thaliana GN=THY-1 PE=1 SV=2 3 321 2.0E-120
sp|Q2QRX6|DRTS_ORYSJ Putative bifunctional dihydrofolate reductase-thymidylate synthase OS=Oryza sativa subsp. japonica GN=Os12g0446900 PE=3 SV=2 3 321 1.0E-119
sp|P51820|DRTS_SOYBN Bifunctional dihydrofolate reductase-thymidylate synthase OS=Glycine max PE=1 SV=1 3 321 4.0E-118
sp|P07607|TYSY_MOUSE Thymidylate synthase OS=Mus musculus GN=Tyms PE=1 SV=1 4 321 2.0E-117
sp|O76511|TYSY_DROME Thymidylate synthase OS=Drosophila melanogaster GN=Ts PE=1 SV=2 2 321 3.0E-117
sp|P45352|TYSY_RAT Thymidylate synthase OS=Rattus norvegicus GN=Tyms PE=1 SV=1 4 321 4.0E-116
sp|P04818|TYSY_HUMAN Thymidylate synthase OS=Homo sapiens GN=TYMS PE=1 SV=3 4 321 5.0E-116
sp|Q27828|DRTS_PARTE Bifunctional dihydrofolate reductase-thymidylate synthase OS=Paramecium tetraurelia GN=GSPATT00019973001 PE=3 SV=1 3 321 5.0E-114
sp|P12462|TYSY_HSVAT Thymidylate synthase OS=Herpesvirus ateles GN=TS PE=3 SV=1 1 321 9.0E-114
sp|P90463|TYSY_HHV8P Thymidylate synthase OS=Human herpesvirus 8 type P (isolate GK18) GN=70 PE=3 SV=1 2 321 5.0E-113
sp|P45350|DRTS_DAUCA Bifunctional dihydrofolate reductase-thymidylate synthase OS=Daucus carota PE=2 SV=1 3 321 6.0E-113
sp|P06854|TYSY_SHV21 Thymidylate synthase OS=Saimiriine herpesvirus 2 (strain 11) GN=70 PE=3 SV=1 4 321 3.0E-112
sp|O96650|TYSY_ASCSU Thymidylate synthase OS=Ascaris suum PE=2 SV=1 2 321 9.0E-112
sp|Q07422|DRTS_TOXGO Bifunctional dihydrofolate reductase-thymidylate synthase OS=Toxoplasma gondii PE=1 SV=1 3 321 5.0E-110
sp|Q2TA32|TYSY_BOVIN Thymidylate synthase OS=Bos taurus GN=TYMS PE=2 SV=1 4 321 5.0E-109
sp|Q27783|DRTS_TRYBB Bifunctional dihydrofolate reductase-thymidylate synthase OS=Trypanosoma brucei brucei PE=1 SV=1 2 321 5.0E-103
sp|O62584|TYS1_ENCCU Thymidylate synthase 1/2 OS=Encephalitozoon cuniculi (strain GB-M1) GN=TS-1 PE=1 SV=2 4 321 8.0E-102
sp|Q8SRG2|TYS3_ENCCU Thymidylate synthase 3 OS=Encephalitozoon cuniculi (strain GB-M1) GN=TS-3 PE=3 SV=1 4 321 1.0E-101
sp|P20712|DRTS_PLACH Bifunctional dihydrofolate reductase-thymidylate synthase OS=Plasmodium chabaudi PE=3 SV=1 4 320 2.0E-99
sp|Q4JQW2|TYSY_VZVO Thymidylate synthase OS=Varicella-zoster virus (strain Oka vaccine) GN=ORF13 PE=3 SV=1 4 321 5.0E-99
sp|P09249|TYSY_VZVD Thymidylate synthase OS=Varicella-zoster virus (strain Dumas) GN=ORF13 PE=3 SV=1 4 321 5.0E-99
sp|Q27793|DRTS_TRYCR Bifunctional dihydrofolate reductase-thymidylate synthase OS=Trypanosoma cruzi PE=1 SV=2 2 321 2.0E-98
sp|P07382|DRTS_LEIMA Bifunctional dihydrofolate reductase-thymidylate synthase OS=Leishmania major GN=LmjF06.0860 PE=1 SV=1 3 321 2.0E-98
sp|P13922|DRTS_PLAFK Bifunctional dihydrofolate reductase-thymidylate synthase OS=Plasmodium falciparum (isolate K1 / Thailand) PE=1 SV=2 4 320 3.0E-98
sp|P16126|DRTS_LEIAM Bifunctional dihydrofolate reductase-thymidylate synthase OS=Leishmania amazonensis PE=3 SV=1 3 321 2.0E-97
sp|Q27713|DRTS_PLABA Bifunctional dihydrofolate reductase-thymidylate synthase OS=Plasmodium berghei (strain Anka) PE=3 SV=1 4 320 2.0E-97
sp|O02604|DRTS_PLAVI Bifunctional dihydrofolate reductase-thymidylate synthase OS=Plasmodium vivax PE=1 SV=2 4 320 3.0E-96
sp|Q9WBI3|TYSY_IIV6 Probable thymidylate synthase 225R OS=Invertebrate iridescent virus 6 GN=IIV6-225R PE=3 SV=1 2 321 1.0E-95
sp|Q23695|DRTS_CRIFA Bifunctional dihydrofolate reductase-thymidylate synthase OS=Crithidia fasciculata PE=3 SV=1 3 321 3.0E-87
sp|C4L1C9|TYSY_EXISA Thymidylate synthase OS=Exiguobacterium sp. (strain ATCC BAA-1283 / AT1b) GN=thyA PE=3 SV=1 6 321 7.0E-83
sp|A1JPC9|TYSY_YERE8 Thymidylate synthase OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=thyA PE=3 SV=1 6 321 1.0E-80
sp|A5FJV8|TYSY_FLAJ1 Thymidylate synthase OS=Flavobacterium johnsoniae (strain ATCC 17061 / DSM 2064 / UW101) GN=thyA PE=3 SV=1 6 321 8.0E-79
sp|Q667F9|TYSY_YERPS Thymidylate synthase OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=thyA PE=3 SV=1 6 321 2.0E-78
sp|A7FFE0|TYSY_YERP3 Thymidylate synthase OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=thyA PE=3 SV=1 6 321 2.0E-78
sp|C6DAE9|TYSY_PECCP Thymidylate synthase OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=thyA PE=3 SV=1 6 321 4.0E-78
sp|A4TLC5|TYSY_YERPP Thymidylate synthase OS=Yersinia pestis (strain Pestoides F) GN=thyA PE=3 SV=1 6 321 4.0E-78
sp|Q1CFB5|TYSY_YERPN Thymidylate synthase OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=thyA PE=3 SV=1 6 321 4.0E-78
sp|Q8ZHV1|TYSY_YERPE Thymidylate synthase OS=Yersinia pestis GN=thyA PE=3 SV=1 6 321 4.0E-78
sp|Q1CAR9|TYSY_YERPA Thymidylate synthase OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=thyA PE=3 SV=1 6 321 4.0E-78
sp|A1KVB3|TYSY_NEIMF Thymidylate synthase OS=Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18) GN=thyA PE=3 SV=1 7 321 4.0E-78
sp|Q8EQG0|TYSY_OCEIH Thymidylate synthase OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=thyA PE=3 SV=1 1 321 5.0E-78
sp|Q6D8I6|TYSY_PECAS Thymidylate synthase OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=thyA PE=3 SV=1 6 321 5.0E-78
sp|O33380|TYSY_NEIGO Thymidylate synthase OS=Neisseria gonorrhoeae GN=thyA PE=3 SV=2 7 321 5.0E-78
sp|Q3SH96|TYSY_THIDA Thymidylate synthase OS=Thiobacillus denitrificans (strain ATCC 25259) GN=thyA PE=3 SV=1 7 321 5.0E-78
sp|Q9JT57|TYSY_NEIMA Thymidylate synthase OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=thyA PE=3 SV=1 7 321 6.0E-78
sp|Q9JY72|TYSY_NEIMB Thymidylate synthase OS=Neisseria meningitidis serogroup B (strain MC58) GN=thyA PE=3 SV=1 7 321 7.0E-78
sp|Q5F732|TYSY_NEIG1 Thymidylate synthase OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=thyA PE=3 SV=1 7 321 1.0E-77
sp|Q7MTB5|TYSY_PORGI Thymidylate synthase OS=Porphyromonas gingivalis (strain ATCC BAA-308 / W83) GN=thyA PE=3 SV=2 6 321 2.0E-77
sp|Q1QUD9|TYSY_CHRSD Thymidylate synthase OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=thyA PE=3 SV=1 7 321 2.0E-77
sp|Q211X8|TYSY_RHOPB Thymidylate synthase OS=Rhodopseudomonas palustris (strain BisB18) GN=thyA PE=3 SV=1 5 321 3.0E-77
sp|Q0C504|TYSY_HYPNA Thymidylate synthase OS=Hyphomonas neptunium (strain ATCC 15444) GN=thyA PE=3 SV=1 5 321 4.0E-77
sp|Q9A6H0|TYSY_CAUCR Thymidylate synthase OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=thyA PE=3 SV=1 4 321 4.0E-77
sp|A7MR31|TYSY_CROS8 Thymidylate synthase OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=thyA PE=3 SV=1 6 321 5.0E-77
sp|A8GIH7|TYSY_SERP5 Thymidylate synthase OS=Serratia proteamaculans (strain 568) GN=thyA PE=3 SV=1 6 321 8.0E-77
sp|Q9RAM7|TYSY_METFK Thymidylate synthase OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) GN=thyA1 PE=3 SV=2 7 321 9.0E-77
sp|C5BH86|TYSY_EDWI9 Thymidylate synthase OS=Edwardsiella ictaluri (strain 93-146) GN=thyA PE=3 SV=1 6 321 9.0E-77
sp|Q47II1|TYSY_DECAR Thymidylate synthase OS=Dechloromonas aromatica (strain RCB) GN=thyA PE=3 SV=1 7 321 1.0E-76
sp|B1IU17|TYSY_ECOLC Thymidylate synthase OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=thyA PE=3 SV=1 6 321 1.0E-76
sp|A8A3W0|TYSY_ECOHS Thymidylate synthase OS=Escherichia coli O9:H4 (strain HS) GN=thyA PE=3 SV=1 6 321 1.0E-76
sp|C0ZI91|TYSY_BREBN Thymidylate synthase OS=Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599) GN=thyA PE=3 SV=1 6 321 1.0E-76
sp|Q7NZ95|TYSY_CHRVO Thymidylate synthase OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=thyA PE=3 SV=1 5 321 1.0E-76
sp|Q32C94|TYSY_SHIDS Thymidylate synthase OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=thyA PE=3 SV=1 6 321 2.0E-76
sp|Q7N8U4|TYSY_PHOLL Thymidylate synthase OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=thyA PE=3 SV=1 6 321 3.0E-76
sp|A6TDG3|TYSY_KLEP7 Thymidylate synthase OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=thyA PE=3 SV=1 6 321 3.0E-76
sp|A8AP42|TYSY_CITK8 Thymidylate synthase OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=thyA PE=3 SV=1 6 321 4.0E-76
sp|Q9K7B5|TYSY_BACHD Thymidylate synthase OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=thyA PE=3 SV=1 6 321 5.0E-76
sp|B7LNI2|TYSY_ESCF3 Thymidylate synthase OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=thyA PE=3 SV=1 6 321 6.0E-76
sp|Q3YY33|TYSY_SHISS Thymidylate synthase OS=Shigella sonnei (strain Ss046) GN=thyA PE=3 SV=1 6 321 6.0E-76
sp|Q1R7I6|TYSY_ECOUT Thymidylate synthase OS=Escherichia coli (strain UTI89 / UPEC) GN=thyA PE=3 SV=1 6 321 6.0E-76
sp|B7N759|TYSY_ECOLU Thymidylate synthase OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=thyA PE=3 SV=1 6 321 6.0E-76
sp|P0A884|TYSY_ECOLI Thymidylate synthase OS=Escherichia coli (strain K12) GN=thyA PE=1 SV=1 6 321 6.0E-76
sp|P0A885|TYSY_ECOL6 Thymidylate synthase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=thyA PE=3 SV=1 6 321 6.0E-76
sp|Q0TE05|TYSY_ECOL5 Thymidylate synthase OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=thyA PE=3 SV=1 6 321 6.0E-76
sp|A1AF39|TYSY_ECOK1 Thymidylate synthase OS=Escherichia coli O1:K1 / APEC GN=thyA PE=3 SV=1 6 321 6.0E-76
sp|C4ZZX9|TYSY_ECOBW Thymidylate synthase OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=thyA PE=3 SV=1 6 321 6.0E-76
sp|B7LY83|TYSY_ECO8A Thymidylate synthase OS=Escherichia coli O8 (strain IAI1) GN=thyA PE=3 SV=1 6 321 6.0E-76
sp|B7MZC6|TYSY_ECO81 Thymidylate synthase OS=Escherichia coli O81 (strain ED1a) GN=thyA PE=3 SV=1 6 321 6.0E-76
sp|B7NVX2|TYSY_ECO7I Thymidylate synthase OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=thyA PE=3 SV=1 6 321 6.0E-76
sp|P0A886|TYSY_ECO57 Thymidylate synthase OS=Escherichia coli O157:H7 GN=thyA PE=1 SV=1 6 321 6.0E-76
sp|B7LF04|TYSY_ECO55 Thymidylate synthase OS=Escherichia coli (strain 55989 / EAEC) GN=thyA PE=3 SV=1 6 321 6.0E-76
sp|B7MLH3|TYSY_ECO45 Thymidylate synthase OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=thyA PE=3 SV=1 6 321 6.0E-76
sp|B7UHP4|TYSY_ECO27 Thymidylate synthase OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=thyA PE=3 SV=1 6 321 6.0E-76
sp|A7ZQT3|TYSY_ECO24 Thymidylate synthase OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=thyA PE=3 SV=1 6 321 6.0E-76
sp|Q2SA17|TYSY_HAHCH Thymidylate synthase OS=Hahella chejuensis (strain KCTC 2396) GN=thyA PE=3 SV=1 6 321 1.0E-75
sp|P48464|TYSY_SHIFL Thymidylate synthase OS=Shigella flexneri GN=thyA PE=2 SV=2 6 321 1.0E-75
sp|Q0T137|TYSY_SHIF8 Thymidylate synthase OS=Shigella flexneri serotype 5b (strain 8401) GN=thyA PE=3 SV=1 6 321 1.0E-75
sp|A2SHH0|TYSY_METPP Thymidylate synthase OS=Methylibium petroleiphilum (strain PM1) GN=thyA PE=3 SV=1 6 321 1.0E-75
sp|Q31XG0|TYSY_SHIBS Thymidylate synthase OS=Shigella boydii serotype 4 (strain Sb227) GN=thyA PE=3 SV=1 6 321 1.0E-75
sp|A0KG32|TYSY_AERHH Thymidylate synthase OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=thyA PE=3 SV=1 7 321 1.0E-75
sp|A4SIW7|TYSY_AERS4 Thymidylate synthase OS=Aeromonas salmonicida (strain A449) GN=thyA PE=3 SV=1 7 321 1.0E-75
sp|Q8ZMA9|TYSY_SALTY Thymidylate synthase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=thyA PE=3 SV=1 6 321 2.0E-75
sp|A9N2L7|TYSY_SALPB Thymidylate synthase OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=thyA PE=3 SV=1 6 321 2.0E-75
sp|Q5PEN6|TYSY_SALPA Thymidylate synthase OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=thyA PE=3 SV=1 6 321 2.0E-75
sp|Q57KB6|TYSY_SALCH Thymidylate synthase OS=Salmonella choleraesuis (strain SC-B67) GN=thyA PE=3 SV=1 6 321 2.0E-75
sp|Q2NRH3|TYSY_SODGM Thymidylate synthase OS=Sodalis glossinidius (strain morsitans) GN=thyA PE=3 SV=1 6 321 2.0E-75
sp|C1D070|TYSY_DEIDV Thymidylate synthase OS=Deinococcus deserti (strain VCD115 / DSM 17065 / LMG 22923) GN=thyA PE=3 SV=1 5 321 2.0E-75
sp|A4WE03|TYSY_ENT38 Thymidylate synthase OS=Enterobacter sp. (strain 638) GN=thyA PE=3 SV=1 6 321 2.0E-75
sp|Q8Z412|TYSY_SALTI Thymidylate synthase OS=Salmonella typhi GN=thyA PE=3 SV=1 6 321 3.0E-75
sp|Q134B1|TYSY_RHOPS Thymidylate synthase OS=Rhodopseudomonas palustris (strain BisB5) GN=thyA PE=3 SV=1 6 321 3.0E-75
sp|Q11VK5|TYSY_CYTH3 Thymidylate synthase OS=Cytophaga hutchinsonii (strain ATCC 33406 / NCIMB 9469) GN=thyA PE=3 SV=1 6 321 8.0E-75
sp|Q8A639|TYSY_BACTN Thymidylate synthase OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) GN=thyA PE=3 SV=1 6 321 1.0E-74
sp|B8IF20|TYSY_METNO Thymidylate synthase OS=Methylobacterium nodulans (strain ORS2060 / LMG 21967) GN=thyA PE=3 SV=1 7 321 1.0E-74
sp|C0PXI9|TYSY_SALPC Thymidylate synthase OS=Salmonella paratyphi C (strain RKS4594) GN=thyA PE=3 SV=1 6 321 1.0E-74
sp|P11044|TYSY2_BACSU Thymidylate synthase 2 OS=Bacillus subtilis (strain 168) GN=thyA2 PE=1 SV=1 6 321 2.0E-74
sp|E0U0H8|TYSY2_BACPZ Thymidylate synthase 2 OS=Bacillus subtilis subsp. spizizenii (strain ATCC 23059 / NRRL B-14472 / W23) GN=thyA2 PE=3 SV=1 6 321 2.0E-74
sp|A1KAF7|TYSY_AZOSB Thymidylate synthase OS=Azoarcus sp. (strain BH72) GN=thyA PE=3 SV=1 5 321 2.0E-74
sp|Q82WU3|TYSY_NITEU Thymidylate synthase OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=thyA PE=3 SV=1 5 321 2.0E-74
sp|Q6A761|TYSY_PROAC Thymidylate synthase OS=Propionibacterium acnes (strain KPA171202 / DSM 16379) GN=thyA PE=3 SV=1 7 321 2.0E-74
sp|A0KZP5|TYSY_SHESA Thymidylate synthase OS=Shewanella sp. (strain ANA-3) GN=thyA PE=3 SV=1 5 321 3.0E-74
sp|Q98KH9|TYSY_RHILO Thymidylate synthase OS=Rhizobium loti (strain MAFF303099) GN=thyA PE=3 SV=1 6 321 4.0E-74
sp|A8FEB9|TYSY_BACP2 Thymidylate synthase OS=Bacillus pumilus (strain SAFR-032) GN=thyA PE=3 SV=1 6 321 4.0E-74
sp|B6JB67|TYSY_OLICO Thymidylate synthase OS=Oligotropha carboxidovorans (strain ATCC 49405 / DSM 1227 / OM5) GN=thyA PE=3 SV=1 5 321 4.0E-74
sp|Q1Q8B2|TYSY_PSYCK Thymidylate synthase OS=Psychrobacter cryohalolentis (strain K5) GN=thyA PE=3 SV=1 1 321 7.0E-74
sp|Q6REU8|TYSY_XENNA Thymidylate synthase OS=Xenorhabdus nematophila (strain ATCC 19061 / DSM 3370 / LMG 1036 / NCIB 9965 / AN6) GN=thyA PE=3 SV=1 6 321 7.0E-74
sp|A9MS82|TYSY_SALAR Thymidylate synthase OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=thyA PE=3 SV=1 6 321 8.0E-74
sp|A1SJ31|TYSY_NOCSJ Thymidylate synthase OS=Nocardioides sp. (strain BAA-499 / JS614) GN=thyA PE=3 SV=1 7 321 8.0E-74
sp|Q0HSH8|TYSY_SHESR Thymidylate synthase OS=Shewanella sp. (strain MR-7) GN=thyA PE=3 SV=1 5 321 8.0E-74
sp|Q0HG85|TYSY_SHESM Thymidylate synthase OS=Shewanella sp. (strain MR-4) GN=thyA PE=3 SV=1 5 321 8.0E-74
sp|Q21U56|TYSY_RHOFT Thymidylate synthase OS=Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118) GN=thyA PE=3 SV=1 6 321 9.0E-74
sp|Q89G35|TYSY_BRADU Thymidylate synthase OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=thyA PE=3 SV=1 5 321 9.0E-74
sp|Q5P233|TYSY_AROAE Thymidylate synthase OS=Aromatoleum aromaticum (strain EbN1) GN=thyA PE=3 SV=1 6 321 9.0E-74
sp|Q168V8|TYSY_ROSDO Thymidylate synthase OS=Roseobacter denitrificans (strain ATCC 33942 / OCh 114) GN=thyA PE=3 SV=1 5 321 1.0E-73
sp|Q8EH94|TYSY_SHEON Thymidylate synthase OS=Shewanella oneidensis (strain MR-1) GN=thyA PE=3 SV=1 5 321 1.0E-73
sp|B8I0T8|TYSY_CLOCE Thymidylate synthase OS=Clostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10) GN=thyA PE=3 SV=1 5 321 1.0E-73
sp|Q2IYG7|TYSY_RHOP2 Thymidylate synthase OS=Rhodopseudomonas palustris (strain HaA2) GN=thyA PE=3 SV=1 7 321 2.0E-73
sp|Q1LSU0|TYSY_BAUCH Thymidylate synthase OS=Baumannia cicadellinicola subsp. Homalodisca coagulata GN=thyA PE=3 SV=1 6 321 2.0E-73
sp|Q6N447|TYSY_RHOPA Thymidylate synthase OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=thyA PE=3 SV=1 6 321 2.0E-73
sp|C1D4I5|TYSY_LARHH Thymidylate synthase OS=Laribacter hongkongensis (strain HLHK9) GN=thyA PE=3 SV=1 7 321 2.0E-73
sp|A1TM53|TYSY_ACIAC Thymidylate synthase OS=Acidovorax citrulli (strain AAC00-1) GN=thyA PE=3 SV=1 6 321 2.0E-73
sp|A5WHY0|TYSY_PSYWF Thymidylate synthase OS=Psychrobacter sp. (strain PRwf-1) GN=thyA PE=3 SV=1 2 321 3.0E-73
sp|A4Y044|TYSY_PSEMY Thymidylate synthase OS=Pseudomonas mendocina (strain ymp) GN=thyA PE=3 SV=1 6 321 3.0E-73
sp|A6L1Q8|TYSY_BACV8 Thymidylate synthase OS=Bacteroides vulgatus (strain ATCC 8482 / DSM 1447 / NCTC 11154) GN=thyA PE=3 SV=1 6 321 3.0E-73
sp|A1S3W8|TYSY_SHEAM Thymidylate synthase OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=thyA PE=3 SV=1 6 321 3.0E-73
sp|A7Z5T3|TYSY_BACMF Thymidylate synthase OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=thyA PE=3 SV=1 6 321 3.0E-73
sp|Q8UDS3|TYSY_AGRFC Thymidylate synthase OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=thyA PE=3 SV=2 6 321 5.0E-73
sp|A5EPD3|TYSY_BRASB Thymidylate synthase OS=Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182) GN=thyA PE=3 SV=1 5 321 7.0E-73
sp|Q1GFV4|TYSY_RUEST Thymidylate synthase OS=Ruegeria sp. (strain TM1040) GN=thyA PE=3 SV=1 5 321 7.0E-73
sp|P54081|TYSY2_BACAM Thymidylate synthase 2 OS=Bacillus amyloliquefaciens GN=thyA2 PE=3 SV=2 6 321 7.0E-73
sp|Q6MID2|TYSY_BDEBA Thymidylate synthase OS=Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIB 9529 / HD100) GN=thyA PE=3 SV=1 6 321 1.0E-72
sp|A1VQZ6|TYSY_POLNA Thymidylate synthase OS=Polaromonas naphthalenivorans (strain CJ2) GN=thyA PE=3 SV=1 5 321 2.0E-72
sp|A1RME0|TYSY_SHESW Thymidylate synthase OS=Shewanella sp. (strain W3-18-1) GN=thyA PE=3 SV=1 5 321 2.0E-72
sp|A4Y4J1|TYSY_SHEPC Thymidylate synthase OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=thyA PE=3 SV=1 5 321 2.0E-72
sp|A6LIC2|TYSY_PARD8 Thymidylate synthase OS=Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / NCTC 11152) GN=thyA PE=3 SV=1 6 321 2.0E-72
sp|Q1QJT8|TYSY_NITHX Thymidylate synthase OS=Nitrobacter hamburgensis (strain X14 / DSM 10229) GN=thyA PE=3 SV=1 5 321 2.0E-72
sp|A7GP90|TYSY_BACCN Thymidylate synthase OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=thyA PE=3 SV=1 4 321 2.0E-72
sp|Q11HI0|TYSY_CHESB Thymidylate synthase OS=Chelativorans sp. (strain BNC1) GN=thyA PE=3 SV=1 6 321 3.0E-72
sp|P67043|TYSY_BRUSU Thymidylate synthase OS=Brucella suis biovar 1 (strain 1330) GN=thyA PE=3 SV=1 7 321 3.0E-72
sp|B0CHI7|TYSY_BRUSI Thymidylate synthase OS=Brucella suis (strain ATCC 23445 / NCTC 10510) GN=thyA PE=3 SV=1 7 321 3.0E-72
sp|P67042|TYSY_BRUME Thymidylate synthase OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=thyA PE=1 SV=1 7 321 3.0E-72
sp|C0RE38|TYSY_BRUMB Thymidylate synthase OS=Brucella melitensis biotype 2 (strain ATCC 23457) GN=thyA PE=3 SV=1 7 321 3.0E-72
sp|Q57CA9|TYSY_BRUAB Thymidylate synthase OS=Brucella abortus biovar 1 (strain 9-941) GN=thyA PE=3 SV=1 7 321 3.0E-72
sp|Q2YS22|TYSY_BRUA2 Thymidylate synthase OS=Brucella abortus (strain 2308) GN=thyA PE=3 SV=1 7 321 3.0E-72
sp|Q1LK81|TYSY_CUPMC Thymidylate synthase OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=thyA PE=3 SV=1 6 321 4.0E-72
sp|Q6AFI0|TYSY_LEIXX Thymidylate synthase OS=Leifsonia xyli subsp. xyli (strain CTCB07) GN=thyA PE=3 SV=1 7 321 4.0E-72
sp|Q7UID0|TYSY_RHOBA Thymidylate synthase OS=Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1) GN=thyA PE=3 SV=1 7 321 5.0E-72
sp|Q5WDS1|TYSY_BACSK Thymidylate synthase OS=Bacillus clausii (strain KSM-K16) GN=thyA PE=3 SV=1 6 321 6.0E-72
sp|Q0AHA4|TYSY_NITEC Thymidylate synthase OS=Nitrosomonas eutropha (strain C91) GN=thyA PE=3 SV=1 5 321 8.0E-72
sp|A4VGL9|TYSY_PSEU5 Thymidylate synthase OS=Pseudomonas stutzeri (strain A1501) GN=thyA PE=3 SV=2 6 321 8.0E-72
sp|Q6HJC7|TYSY_BACHK Thymidylate synthase OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=thyA PE=3 SV=1 4 321 8.0E-72
sp|Q81R23|TYSY_BACAN Thymidylate synthase OS=Bacillus anthracis GN=thyA PE=3 SV=1 4 321 8.0E-72
sp|A0RDL9|TYSY_BACAH Thymidylate synthase OS=Bacillus thuringiensis (strain Al Hakam) GN=thyA PE=3 SV=1 4 321 8.0E-72
sp|Q6NIF2|TYSY_CORDI Thymidylate synthase OS=Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis) GN=thyA PE=3 SV=1 7 321 9.0E-72
sp|A4YZC4|TYSY_BRASO Thymidylate synthase OS=Bradyrhizobium sp. (strain ORS278) GN=thyA PE=3 SV=1 5 321 9.0E-72
sp|Q81E05|TYSY_BACCR Thymidylate synthase OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=thyA PE=3 SV=1 4 321 1.0E-71
sp|Q738X7|TYSY_BACC1 Thymidylate synthase OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=thyA PE=3 SV=1 4 321 1.0E-71
sp|A0LY29|TYSY_GRAFK Thymidylate synthase OS=Gramella forsetii (strain KT0803) GN=thyA PE=3 SV=1 6 321 1.0E-71
sp|Q63BV5|TYSY_BACCZ Thymidylate synthase OS=Bacillus cereus (strain ZK / E33L) GN=thyA PE=3 SV=1 4 321 1.0E-71
sp|Q834R3|TYSY_ENTFA Thymidylate synthase OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=thyA PE=1 SV=1 4 321 1.0E-71
sp|A5VRE7|TYSY_BRUO2 Thymidylate synthase OS=Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512) GN=thyA PE=3 SV=1 7 321 1.0E-71
sp|Q0K889|TYSY_CUPNH Thymidylate synthase OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=thyA PE=3 SV=2 6 321 2.0E-71
sp|B7GI39|TYSY_ANOFW Thymidylate synthase OS=Anoxybacillus flavithermus (strain DSM 21510 / WK1) GN=thyA PE=3 SV=1 6 321 2.0E-71
sp|Q5L9L6|TYSY_BACFN Thymidylate synthase OS=Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / JCM 11019 / NCTC 9343) GN=thyA PE=3 SV=1 6 321 2.0E-71
sp|A5VJK9|TYSY_LACRD Thymidylate synthase OS=Lactobacillus reuteri (strain DSM 20016) GN=thyA PE=3 SV=1 4 321 2.0E-71
sp|Q12KG8|TYSY_SHEDO Thymidylate synthase OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=thyA PE=3 SV=1 6 321 2.0E-71
sp|A0JZC7|TYSY_ARTS2 Thymidylate synthase OS=Arthrobacter sp. (strain FB24) GN=thyA PE=3 SV=1 7 321 2.0E-71
sp|A6GWH3|TYSY_FLAPJ Thymidylate synthase OS=Flavobacterium psychrophilum (strain JIP02/86 / ATCC 49511) GN=thyA PE=3 SV=1 6 321 2.0E-71
sp|Q5KZ25|TYSY_GEOKA Thymidylate synthase OS=Geobacillus kaustophilus (strain HTA426) GN=thyA PE=3 SV=1 6 321 2.0E-71
sp|A9M657|TYSY_BRUC2 Thymidylate synthase OS=Brucella canis (strain ATCC 23365 / NCTC 10854) GN=thyA PE=3 SV=1 7 321 2.0E-71
sp|Q3SQ36|TYSY_NITWN Thymidylate synthase OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=thyA PE=3 SV=1 5 321 3.0E-71
sp|Q8K9C3|TYSY_BUCAP Thymidylate synthase OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=thyA PE=3 SV=1 6 321 3.0E-71
sp|A6WZV4|TYSY_OCHA4 Thymidylate synthase OS=Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / NCTC 12168) GN=thyA PE=3 SV=1 7 321 3.0E-71
sp|A1W5A4|TYSY_ACISJ Thymidylate synthase OS=Acidovorax sp. (strain JS42) GN=thyA PE=3 SV=1 5 321 3.0E-71
sp|A1U3D8|TYSY_MARHV Thymidylate synthase OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=thyA PE=3 SV=1 7 321 4.0E-71
sp|Q64PV5|TYSY_BACFR Thymidylate synthase OS=Bacteroides fragilis (strain YCH46) GN=thyA PE=3 SV=1 6 321 9.0E-71
sp|B7KQG2|TYSY_METC4 Thymidylate synthase OS=Methylobacterium extorquens (strain CM4 / NCIMB 13688) GN=thyA PE=3 SV=1 7 321 1.0E-70
sp|A1R8Y7|TYSY_ARTAT Thymidylate synthase OS=Arthrobacter aurescens (strain TC1) GN=thyA PE=3 SV=1 7 321 1.0E-70
sp|A3D1U3|TYSY_SHEB5 Thymidylate synthase OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=thyA PE=3 SV=1 6 321 2.0E-70
sp|A0PQG7|TYSY_MYCUA Thymidylate synthase OS=Mycobacterium ulcerans (strain Agy99) GN=thyA PE=3 SV=1 7 321 2.0E-70
sp|B7I4U0|TYSY_ACIB5 Thymidylate synthase OS=Acinetobacter baumannii (strain AB0057) GN=thyA PE=3 SV=1 7 321 2.0E-70
sp|B7H0P4|TYSY_ACIB3 Thymidylate synthase OS=Acinetobacter baumannii (strain AB307-0294) GN=thyA PE=3 SV=1 7 321 2.0E-70
sp|B8EBR5|TYSY_SHEB2 Thymidylate synthase OS=Shewanella baltica (strain OS223) GN=thyA PE=3 SV=1 6 321 2.0E-70
sp|A6UYE6|TYSY_PSEA7 Thymidylate synthase OS=Pseudomonas aeruginosa (strain PA7) GN=thyA PE=3 SV=1 6 321 2.0E-70
sp|A7HVX4|TYSY_PARL1 Thymidylate synthase OS=Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966) GN=thyA PE=3 SV=1 5 321 2.0E-70
sp|A4INY1|TYSY_GEOTN Thymidylate synthase OS=Geobacillus thermodenitrificans (strain NG80-2) GN=thyA PE=3 SV=1 6 321 3.0E-70
sp|Q12CI6|TYSY_POLSJ Thymidylate synthase OS=Polaromonas sp. (strain JS666 / ATCC BAA-500) GN=thyA PE=3 SV=1 6 321 4.0E-70
sp|Q1BA64|TYSY_MYCSS Thymidylate synthase OS=Mycobacterium sp. (strain MCS) GN=thyA PE=3 SV=1 7 321 4.0E-70
sp|A1UEU8|TYSY_MYCSK Thymidylate synthase OS=Mycobacterium sp. (strain KMS) GN=thyA PE=3 SV=1 7 321 4.0E-70
sp|A3PYA8|TYSY_MYCSJ Thymidylate synthase OS=Mycobacterium sp. (strain JLS) GN=thyA PE=3 SV=1 7 321 4.0E-70
sp|B8ELI3|TYSY_METSB Thymidylate synthase OS=Methylocella silvestris (strain BL2 / DSM 15510 / NCIMB 13906) GN=thyA PE=3 SV=1 5 321 4.0E-70
sp|A4SVT7|TYSY_POLSQ Thymidylate synthase OS=Polynucleobacter necessarius subsp. asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1) GN=thyA PE=3 SV=1 6 321 5.0E-70
sp|Q6FER7|TYSY_ACIAD Thymidylate synthase OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=thyA PE=3 SV=1 7 321 5.0E-70
sp|Q9I6F1|TYSY_PSEAE Thymidylate synthase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=thyA PE=3 SV=1 6 321 6.0E-70
sp|Q02U73|TYSY_PSEAB Thymidylate synthase OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=thyA PE=3 SV=1 6 321 6.0E-70
sp|B7V2Q5|TYSY_PSEA8 Thymidylate synthase OS=Pseudomonas aeruginosa (strain LESB58) GN=thyA PE=3 SV=1 6 321 6.0E-70
sp|Q8NS38|TYSY_CORGL Thymidylate synthase OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=thyA PE=1 SV=1 7 321 6.0E-70
sp|A4QCI7|TYSY_CORGB Thymidylate synthase OS=Corynebacterium glutamicum (strain R) GN=thyA PE=3 SV=1 7 321 6.0E-70
sp|Q9CBW0|TYSY_MYCLE Thymidylate synthase OS=Mycobacterium leprae (strain TN) GN=thyA PE=3 SV=1 7 321 6.0E-70
sp|A9L5M3|TYSY_SHEB9 Thymidylate synthase OS=Shewanella baltica (strain OS195) GN=thyA PE=3 SV=1 6 321 6.0E-70
sp|A6WKP4|TYSY_SHEB8 Thymidylate synthase OS=Shewanella baltica (strain OS185) GN=thyA PE=3 SV=1 6 321 6.0E-70
sp|Q8G3T9|TYSY_BIFLO Thymidylate synthase OS=Bifidobacterium longum (strain NCC 2705) GN=thyA PE=3 SV=1 7 321 7.0E-70
sp|Q6G2S8|TYSY_BARHE Thymidylate synthase OS=Bartonella henselae (strain ATCC 49882 / DSM 28221 / Houston 1) GN=thyA PE=3 SV=1 7 319 1.0E-69
sp|Q5YPL7|TYSY_NOCFA Thymidylate synthase OS=Nocardia farcinica (strain IFM 10152) GN=thyA PE=3 SV=1 1 321 1.0E-69
sp|Q4JX59|TYSY_CORJK Thymidylate synthase OS=Corynebacterium jeikeium (strain K411) GN=thyA PE=3 SV=1 7 321 1.0E-69
sp|Q6F145|TYSY_MESFL Thymidylate synthase OS=Mesoplasma florum (strain ATCC 33453 / NBRC 100688 / NCTC 11704 / L1) GN=thyA PE=3 SV=1 6 321 1.0E-69
sp|A4TCI9|TYSY_MYCGI Thymidylate synthase OS=Mycobacterium gilvum (strain PYR-GCK) GN=thyA PE=3 SV=1 1 321 1.0E-69
sp|Q2W7P4|TYSY_MAGSA Thymidylate synthase OS=Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) GN=thyA PE=3 SV=2 5 321 2.0E-69
sp|Q6KIQ6|TYSY_MYCMO Thymidylate synthase OS=Mycoplasma mobile (strain ATCC 43663 / 163K / NCTC 11711) GN=thyA PE=3 SV=1 6 321 2.0E-69
sp|Q0ABR1|TYSY_ALKEH Thymidylate synthase OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=thyA PE=3 SV=1 7 321 2.0E-69
sp|A1T7P4|TYSY_MYCVP Thymidylate synthase OS=Mycobacterium vanbaalenii (strain DSM 7251 / PYR-1) GN=thyA PE=3 SV=1 7 321 2.0E-69
sp|Q8Y0U6|TYSY_RALSO Thymidylate synthase OS=Ralstonia solanacearum (strain GMI1000) GN=thyA PE=3 SV=1 7 321 2.0E-69
sp|Q1ME82|TYSY_RHIL3 Thymidylate synthase OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=thyA PE=3 SV=1 6 321 2.0E-69
sp|B8GN06|TYSY_THISH Thymidylate synthase OS=Thioalkalivibrio sulfidiphilus (strain HL-EbGR7) GN=thyA PE=3 SV=1 7 321 2.0E-69
sp|C5DAR2|TYSY_GEOSW Thymidylate synthase OS=Geobacillus sp. (strain WCH70) GN=thyA PE=3 SV=1 6 321 2.0E-69
sp|A1AWQ8|TYSY_RUTMC Thymidylate synthase OS=Ruthia magnifica subsp. Calyptogena magnifica GN=thyA PE=3 SV=1 6 309 2.0E-69
sp|P00469|TYSY_LACCA Thymidylate synthase OS=Lactobacillus casei GN=thyA PE=1 SV=1 4 321 3.0E-69
sp|C5BMA3|TYSY_TERTT Thymidylate synthase OS=Teredinibacter turnerae (strain ATCC 39867 / T7901) GN=thyA PE=3 SV=1 6 321 5.0E-69
sp|A6UB24|TYSY_SINMW Thymidylate synthase OS=Sinorhizobium medicae (strain WSM419) GN=thyA PE=3 SV=1 6 321 6.0E-69
sp|Q0VM06|TYSY_ALCBS Thymidylate synthase OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=thyA PE=3 SV=1 6 321 6.0E-69
sp|P9WFR9|TYSY_MYCTU Thymidylate synthase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=thyA PE=1 SV=1 7 321 7.0E-69
sp|P9WFR8|TYSY_MYCTO Thymidylate synthase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=thyA PE=3 SV=1 7 321 7.0E-69
sp|A5U6B7|TYSY_MYCTA Thymidylate synthase OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=thyA PE=3 SV=1 7 321 7.0E-69
sp|C1AFM7|TYSY_MYCBT Thymidylate synthase OS=Mycobacterium bovis (strain BCG / Tokyo 172 / ATCC 35737 / TMC 1019) GN=thyA PE=3 SV=1 7 321 7.0E-69
sp|A1KMA6|TYSY_MYCBP Thymidylate synthase OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=thyA PE=3 SV=1 7 321 7.0E-69
sp|P67045|TYSY_MYCBO Thymidylate synthase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=thyA PE=3 SV=1 7 321 7.0E-69
sp|A0QIU1|TYSY_MYCA1 Thymidylate synthase OS=Mycobacterium avium (strain 104) GN=thyA PE=3 SV=1 7 321 7.0E-69
sp|A9NG27|TYSY_ACHLI Thymidylate synthase OS=Acholeplasma laidlawii (strain PG-8A) GN=thyA PE=3 SV=1 6 321 8.0E-69
sp|Q2K6G8|TYSY_RHIEC Thymidylate synthase OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=thyA PE=3 SV=1 5 321 9.0E-69
sp|Q8FR47|TYSY_COREF Thymidylate synthase OS=Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395) GN=thyA PE=3 SV=1 7 321 1.0E-68
sp|Q73VZ2|TYSY_MYCPA Thymidylate synthase OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=thyA PE=3 SV=1 7 321 1.0E-68
sp|B9JXQ5|TYSY_AGRVS Thymidylate synthase OS=Agrobacterium vitis (strain S4 / ATCC BAA-846) GN=thyA PE=3 SV=1 6 321 1.0E-68
sp|Q92NQ5|TYSY_RHIME Thymidylate synthase OS=Rhizobium meliloti (strain 1021) GN=thyA PE=3 SV=1 6 321 2.0E-68
sp|Q8PP46|TYSY_XANAC Thymidylate synthase OS=Xanthomonas axonopodis pv. citri (strain 306) GN=thyA PE=3 SV=1 7 321 2.0E-68
sp|Q3BX87|TYSY_XANC5 Thymidylate synthase OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=thyA PE=3 SV=1 7 321 2.0E-68
sp|A5CWK3|TYSY_VESOH Thymidylate synthase OS=Vesicomyosocius okutanii subsp. Calyptogena okutanii (strain HA) GN=thyA PE=3 SV=1 6 309 2.0E-68
sp|B8D9L8|TYSY_BUCA5 Thymidylate synthase OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A) GN=thyA PE=3 SV=1 6 321 2.0E-68
sp|C4K7G3|TYSY_HAMD5 Thymidylate synthase OS=Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT) GN=thyA PE=3 SV=1 6 321 2.0E-68
sp|B0TYI1|TYSY_FRAP2 Thymidylate synthase OS=Francisella philomiragia subsp. philomiragia (strain ATCC 25017) GN=thyA PE=3 SV=1 6 321 2.0E-68
sp|Q039F7|TYSY_LACC3 Thymidylate synthase OS=Lactobacillus casei (strain ATCC 334) GN=thyA PE=3 SV=1 4 321 3.0E-68
sp|C1KWH4|TYSY_LISMC Thymidylate synthase OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=thyA PE=3 SV=1 6 321 3.0E-68
sp|Q87BT4|TYSY_XYLFT Thymidylate synthase OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=thyA PE=3 SV=1 6 321 3.0E-68
sp|P47469|TYSY_MYCGE Thymidylate synthase OS=Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) GN=thyA PE=3 SV=1 6 321 3.0E-68
sp|Q92AD4|TYSY_LISIN Thymidylate synthase OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=thyA PE=3 SV=1 6 321 5.0E-68
sp|Q6FZ91|TYSY_BARQU Thymidylate synthase OS=Bartonella quintana (strain Toulouse) GN=thyA PE=3 SV=1 7 319 5.0E-68
sp|Q8Y626|TYSY_LISMO Thymidylate synthase OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=thyA PE=3 SV=1 6 321 5.0E-68
sp|P78029|TYSY_MYCPN Thymidylate synthase OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) GN=thyA PE=3 SV=2 5 321 6.0E-68
sp|Q9PB13|TYSY_XYLFA Thymidylate synthase OS=Xylella fastidiosa (strain 9a5c) GN=thyA PE=3 SV=1 6 321 8.0E-68
sp|Q71YE1|TYSY_LISMF Thymidylate synthase OS=Listeria monocytogenes serotype 4b (strain F2365) GN=thyA PE=3 SV=1 6 321 1.0E-67
sp|B8D7X0|TYSY_BUCAT Thymidylate synthase OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7) GN=thyA PE=3 SV=1 6 321 1.0E-67
sp|C1DK16|TYSY_AZOVD Thymidylate synthase OS=Azotobacter vinelandii (strain DJ / ATCC BAA-1303) GN=thyA PE=3 SV=1 6 321 1.0E-67
sp|B8DDM8|TYSY_LISMH Thymidylate synthase OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=thyA PE=3 SV=1 6 321 1.0E-67
sp|Q5GWB5|TYSY_XANOR Thymidylate synthase OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=thyA PE=3 SV=1 7 321 1.0E-67
sp|Q2NZH9|TYSY_XANOM Thymidylate synthase OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=thyA PE=3 SV=1 7 321 1.0E-67
sp|A9IW82|TYSY_BART1 Thymidylate synthase OS=Bartonella tribocorum (strain CIP 105476 / IBS 506) GN=thyA PE=3 SV=1 7 321 1.0E-67
sp|P57515|TYSY_BUCAI Thymidylate synthase OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=thyA PE=3 SV=1 6 321 2.0E-67
sp|Q03F96|TYSY_PEDPA Thymidylate synthase OS=Pediococcus pentosaceus (strain ATCC 25745 / 183-1w) GN=thyA PE=3 SV=1 4 321 2.0E-67
sp|Q1WU17|TYSY_LACS1 Thymidylate synthase OS=Lactobacillus salivarius (strain UCC118) GN=thyA PE=3 SV=1 4 321 2.0E-67
sp|Q88W05|TYSY_LACPL Thymidylate synthase OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=thyA PE=3 SV=1 4 321 2.0E-67
sp|Q4L6D7|TYSY_STAHJ Thymidylate synthase OS=Staphylococcus haemolyticus (strain JCSC1435) GN=thyA PE=3 SV=1 7 321 2.0E-67
sp|Q07PP0|TYSY_RHOP5 Thymidylate synthase OS=Rhodopseudomonas palustris (strain BisA53) GN=thyA PE=3 SV=2 4 321 4.0E-67
sp|A4IXE8|TYSY_FRATW Thymidylate synthase OS=Francisella tularensis subsp. tularensis (strain WY96-3418) GN=thyA PE=3 SV=1 6 321 4.0E-67
sp|A0Q7B4|TYSY_FRATN Thymidylate synthase OS=Francisella tularensis subsp. novicida (strain U112) GN=thyA PE=3 SV=1 6 321 4.0E-67
sp|A5II41|TYSY_LEGPC Thymidylate synthase OS=Legionella pneumophila (strain Corby) GN=thyA PE=3 SV=1 7 321 4.0E-67
sp|Q5X119|TYSY_LEGPA Thymidylate synthase OS=Legionella pneumophila (strain Paris) GN=thyA PE=3 SV=1 7 321 5.0E-67
sp|A0AJY0|TYSY_LISW6 Thymidylate synthase OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=thyA PE=3 SV=1 6 321 7.0E-67
sp|Q9Z671|TYSY_ZYMMO Thymidylate synthase OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=thyA PE=3 SV=3 3 321 2.0E-66
sp|A1UTA5|TYSY_BARBK Thymidylate synthase OS=Bartonella bacilliformis (strain ATCC 35685 / KC583) GN=thyA PE=3 SV=1 7 319 2.0E-66
sp|Q8PCE7|TYSY_XANCP Thymidylate synthase OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=thyA PE=3 SV=1 7 321 2.0E-66
sp|Q4UR35|TYSY_XANC8 Thymidylate synthase OS=Xanthomonas campestris pv. campestris (strain 8004) GN=thyA PE=3 SV=1 7 321 2.0E-66
sp|Q83BG2|TYSY_COXBU Thymidylate synthase OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=thyA PE=3 SV=1 6 321 2.0E-66
sp|A9N980|TYSY_COXBR Thymidylate synthase OS=Coxiella burnetii (strain RSA 331 / Henzerling II) GN=thyA PE=3 SV=1 6 321 2.0E-66
sp|A9KF61|TYSY_COXBN Thymidylate synthase OS=Coxiella burnetii (strain Dugway 5J108-111) GN=thyA PE=3 SV=1 6 321 2.0E-66
sp|Q5NFK5|TYSY_FRATT Thymidylate synthase OS=Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4) GN=thyA PE=3 SV=1 5 321 2.0E-66
sp|Q14H07|TYSY_FRAT1 Thymidylate synthase OS=Francisella tularensis subsp. tularensis (strain FSC 198) GN=thyA PE=3 SV=1 5 321 2.0E-66
sp|Q0SEI1|TYSY_RHOJR Thymidylate synthase OS=Rhodococcus jostii (strain RHA1) GN=thyA PE=3 SV=1 7 321 3.0E-66
sp|Q5WSU5|TYSY_LEGPL Thymidylate synthase OS=Legionella pneumophila (strain Lens) GN=thyA PE=3 SV=1 7 321 3.0E-66
sp|B9JH03|TYSY_AGRRK Thymidylate synthase OS=Agrobacterium radiobacter (strain K84 / ATCC BAA-868) GN=thyA PE=3 SV=1 4 321 3.0E-66
sp|A4WQT6|TYSY_RHOS5 Thymidylate synthase OS=Rhodobacter sphaeroides (strain ATCC 17025 / ATH 2.4.3) GN=thyA PE=3 SV=1 4 321 4.0E-66
sp|Q2NJ46|TYSY_AYWBP Thymidylate synthase OS=Aster yellows witches'-broom phytoplasma (strain AYWB) GN=thyA PE=3 SV=1 7 309 4.0E-66
sp|Q8EV81|TYSY_MYCPE Thymidylate synthase OS=Mycoplasma penetrans (strain HF-2) GN=thyA PE=3 SV=1 6 321 5.0E-66
sp|C3MEE8|TYSY_RHISN Thymidylate synthase OS=Rhizobium sp. (strain NGR234) GN=thyA PE=3 SV=1 4 321 7.0E-66
sp|Q0BMM0|TYSY_FRATO Thymidylate synthase OS=Francisella tularensis subsp. holarctica (strain OSU18) GN=thyA PE=3 SV=1 6 321 7.0E-66
sp|Q2A486|TYSY_FRATH Thymidylate synthase OS=Francisella tularensis subsp. holarctica (strain LVS) GN=thyA PE=3 SV=1 6 321 7.0E-66
sp|A7NB78|TYSY_FRATF Thymidylate synthase OS=Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA) GN=thyA PE=3 SV=1 6 321 7.0E-66
sp|C3PEY5|TYSY_CORA7 Thymidylate synthase OS=Corynebacterium aurimucosum (strain ATCC 700975 / DSM 44827 / CN-1) GN=thyA PE=3 SV=1 4 321 8.0E-66
sp|Q5UQG3|DRTS_MIMIV Bifunctional dihydrofolate reductase-thymidylate synthase OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R497 PE=3 SV=1 4 319 1.0E-65
sp|Q6YQT0|TYSY_ONYPE Thymidylate synthase OS=Onion yellows phytoplasma (strain OY-M) GN=thyA PE=3 SV=1 7 309 2.0E-65
sp|A1WYP9|TYSY_HALHL Thymidylate synthase OS=Halorhodospira halophila (strain DSM 244 / SL1) GN=thyA PE=3 SV=1 7 321 2.0E-65
sp|Q5ZRL3|TYSY_LEGPH Thymidylate synthase OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=thyA PE=3 SV=1 7 321 2.0E-65
sp|P00471|TYSY_BPT4 Thymidylate synthase OS=Enterobacteria phage T4 GN=TD PE=1 SV=1 6 321 3.0E-65
sp|A0QVR9|TYSY_MYCS2 Thymidylate synthase OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=thyA PE=3 SV=1 7 321 5.0E-65
sp|Q21NW5|TYSY_SACD2 Thymidylate synthase OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=thyA PE=3 SV=1 6 321 8.0E-65
sp|A3PLD1|TYSY_RHOS1 Thymidylate synthase OS=Rhodobacter sphaeroides (strain ATCC 17029 / ATH 2.4.9) GN=thyA PE=3 SV=1 4 321 8.0E-65
sp|Q03S95|TYSY_LACBA Thymidylate synthase OS=Lactobacillus brevis (strain ATCC 367 / JCM 1170) GN=thyA PE=3 SV=1 4 321 8.0E-65
sp|Q3JEI2|TYSY_NITOC Thymidylate synthase OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=thyA PE=3 SV=1 7 321 8.0E-65
sp|A6WGF9|TYSY_KINRD Thymidylate synthase OS=Kineococcus radiotolerans (strain ATCC BAA-149 / DSM 14245 / SRS30216) GN=thyA PE=3 SV=1 6 321 1.0E-64
sp|Q31I55|TYSY_THICR Thymidylate synthase OS=Thiomicrospira crunogena (strain XCL-2) GN=thyA PE=3 SV=1 6 321 3.0E-64
sp|Q3J0W9|TYSY_RHOS4 Thymidylate synthase OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=thyA PE=3 SV=1 4 321 3.0E-64
sp|C0QWM9|TYSY_BRAHW Thymidylate synthase OS=Brachyspira hyodysenteriae (strain ATCC 49526 / WA1) GN=thyA PE=3 SV=1 5 321 3.0E-64
sp|Q9XC19|TYSY_MYCGA Thymidylate synthase OS=Mycoplasma gallisepticum (strain R(low / passage 15 / clone 2)) GN=thyA PE=3 SV=2 7 321 4.0E-64
sp|Q603S2|TYSY_METCA Thymidylate synthase OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=thyA PE=3 SV=1 7 321 2.0E-63
sp|Q98Q31|TYSY_MYCPU Thymidylate synthase OS=Mycoplasma pulmonis (strain UAB CTIP) GN=thyA PE=3 SV=1 6 293 6.0E-63
sp|Q4A611|TYSY_MYCS5 Thymidylate synthase OS=Mycoplasma synoviae (strain 53) GN=thyA PE=3 SV=1 6 321 5.0E-62
sp|A8Z406|TYSY_STAAT Thymidylate synthase OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=thyA PE=3 SV=1 7 321 9.0E-62
sp|Q6GGY0|TYSY_STAAR Thymidylate synthase OS=Staphylococcus aureus (strain MRSA252) GN=thyA PE=3 SV=1 7 321 9.0E-62
sp|A6QGX8|TYSY_STAAE Thymidylate synthase OS=Staphylococcus aureus (strain Newman) GN=thyA PE=3 SV=1 7 321 9.0E-62
sp|Q5HFZ6|TYSY_STAAC Thymidylate synthase OS=Staphylococcus aureus (strain COL) GN=thyA PE=3 SV=1 7 321 9.0E-62
sp|Q2YY40|TYSY_STAAB Thymidylate synthase OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=thyA PE=3 SV=1 7 321 9.0E-62
sp|Q2FYK5|TYSY_STAA8 Thymidylate synthase OS=Staphylococcus aureus (strain NCTC 8325) GN=thyA PE=3 SV=1 7 321 9.0E-62
sp|Q2FH11|TYSY_STAA3 Thymidylate synthase OS=Staphylococcus aureus (strain USA300) GN=thyA PE=3 SV=1 7 321 9.0E-62
sp|A5EVG5|TYSY_DICNV Thymidylate synthase OS=Dichelobacter nodosus (strain VCS1703A) GN=thyA PE=3 SV=1 18 321 1.0E-61
sp|P67048|TYSY_STAAW Thymidylate synthase OS=Staphylococcus aureus (strain MW2) GN=thyA PE=3 SV=1 7 321 1.0E-61
sp|Q6G9D4|TYSY_STAAS Thymidylate synthase OS=Staphylococcus aureus (strain MSSA476) GN=thyA PE=3 SV=1 7 321 1.0E-61
sp|P67047|TYSY_STAAN Thymidylate synthase OS=Staphylococcus aureus (strain N315) GN=thyA PE=3 SV=1 7 321 1.0E-61
sp|P67046|TYSY_STAAM Thymidylate synthase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=thyA PE=1 SV=1 7 321 1.0E-61
sp|A5ISV8|TYSY_STAA9 Thymidylate synthase OS=Staphylococcus aureus (strain JH9) GN=thyA PE=3 SV=1 7 321 1.0E-61
sp|A6U1P7|TYSY_STAA2 Thymidylate synthase OS=Staphylococcus aureus (strain JH1) GN=thyA PE=3 SV=1 7 321 1.0E-61
sp|A7X2B3|TYSY_STAA1 Thymidylate synthase OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=thyA PE=3 SV=1 7 321 1.0E-61
sp|Q044A1|TYSY_LACGA Thymidylate synthase OS=Lactobacillus gasseri (strain ATCC 33323 / DSM 20243 / JCM 1131 / NCIMB 11718 / AM63) GN=thyA PE=3 SV=1 4 321 1.0E-61
sp|P59427|TYSY_BUCBP Thymidylate synthase OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=thyA PE=3 SV=1 7 321 2.0E-61
sp|Q49XN8|TYSY_STAS1 Thymidylate synthase OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=thyA PE=3 SV=1 4 321 2.0E-61
sp|B3QZX0|TYSY_PHYMT Thymidylate synthase OS=Phytoplasma mali (strain AT) GN=thyA PE=3 SV=1 7 288 3.0E-61
sp|Q38WX8|TYSY_LACSS Thymidylate synthase OS=Lactobacillus sakei subsp. sakei (strain 23K) GN=thyA PE=3 SV=1 4 321 4.0E-61
sp|P0C0M5|TYSY_STAES Thymidylate synthase OS=Staphylococcus epidermidis (strain ATCC 12228) GN=thyA PE=3 SV=1 7 321 7.0E-61
sp|Q5HMP6|TYSY_STAEQ Thymidylate synthase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=thyA1 PE=3 SV=1 7 321 7.0E-61
sp|P0A0M5|TYSY_STAAU Thymidylate synthase OS=Staphylococcus aureus GN=thyA PE=3 SV=1 7 321 7.0E-61
sp|Q2G6V6|TYSY_NOVAD Thymidylate synthase OS=Novosphingobium aromaticivorans (strain DSM 12444 / F199) GN=thyA PE=3 SV=2 4 319 7.0E-61
sp|A5VCW6|TYSY_SPHWW Thymidylate synthase OS=Sphingomonas wittichii (strain RW1 / DSM 6014 / JCM 10273) GN=thyA PE=3 SV=1 4 321 8.0E-60
sp|Q1GTH6|TYSY_SPHAL Thymidylate synthase OS=Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256) GN=thyA PE=3 SV=2 4 321 9.0E-60
sp|A8YUW0|TYSY_LACH4 Thymidylate synthase OS=Lactobacillus helveticus (strain DPC 4571) GN=thyA PE=3 SV=1 4 321 2.0E-59
sp|Q74IU3|TYSY_LACJO Thymidylate synthase OS=Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533) GN=thyA PE=3 SV=1 4 321 3.0E-59
sp|A5WAK1|TYSY_PSEP1 Thymidylate synthase OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=thyA PE=3 SV=1 7 321 6.0E-58
sp|C3K3Q8|TYSY_PSEFS Thymidylate synthase OS=Pseudomonas fluorescens (strain SBW25) GN=thyA PE=3 SV=1 6 321 8.0E-58
sp|Q04B29|TYSY_LACDB Thymidylate synthase OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC BAA-365) GN=thyA PE=3 SV=1 2 286 3.0E-57
sp|Q1GAP2|TYSY_LACDA Thymidylate synthase OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081 / JCM 1002 / NBRC 13953 / NCIMB 11778) GN=thyA PE=3 SV=1 2 286 3.0E-57
sp|Q5FKL6|TYSY_LACAC Thymidylate synthase OS=Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM) GN=thyA PE=3 SV=1 4 321 4.0E-57
sp|Q67JQ1|TYSY_SYMTH Thymidylate synthase OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=thyA PE=3 SV=1 1 321 6.0E-55
sp|Q03YZ8|TYSY_LEUMM Thymidylate synthase OS=Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / NCDO 523) GN=thyA PE=3 SV=1 2 321 2.0E-54
sp|Q8D2N4|TYSY_WIGBR Thymidylate synthase OS=Wigglesworthia glossinidia brevipalpis GN=thyA PE=3 SV=1 6 321 5.0E-53
sp|Q7VUE3|TYSY_BORPE Thymidylate synthase OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=thyA PE=3 SV=1 6 321 8.0E-48
sp|Q04FR4|TYSY_OENOB Thymidylate synthase OS=Oenococcus oeni (strain ATCC BAA-331 / PSU-1) GN=thyA PE=3 SV=1 2 288 1.0E-46
sp|Q7W1A9|TYSY_BORPA Thymidylate synthase OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=thyA PE=3 SV=1 6 321 6.0E-46
sp|Q7WP13|TYSY_BORBR Thymidylate synthase OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=thyA PE=3 SV=1 6 321 6.0E-46
sp|Q88CN9|TYSY_PSEPK Thymidylate synthase OS=Pseudomonas putida (strain KT2440) GN=thyA PE=3 SV=1 6 321 1.0E-41
sp|A6M378|TYSY_CLOB8 Thymidylate synthase OS=Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052) GN=thyA PE=3 SV=1 4 321 2.0E-40
sp|Q97EV3|TYSY_CLOAB Thymidylate synthase OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=thyA PE=3 SV=1 2 321 1.0E-39
sp|Q87UL4|TYSY_PSESM Thymidylate synthase OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=thyA PE=3 SV=1 6 321 2.0E-39
sp|Q9ANR7|TYSY_BACMO Thymidylate synthase A OS=Bacillus mojavensis GN=thyA PE=3 SV=1 2 288 1.0E-32
sp|E0TVT6|TYSY1_BACPZ Thymidylate synthase 1 OS=Bacillus subtilis subsp. spizizenii (strain ATCC 23059 / NRRL B-14472 / W23) GN=thyA1 PE=3 SV=1 2 288 3.0E-32
sp|P07606|TYSY_BPPHT Thymidylate synthase OS=Bacillus phage phi3T GN=thyP3 PE=3 SV=1 2 288 4.0E-32
sp|Q5D189|TYSY_BACNA Thymidylate synthase OS=Bacillus subtilis subsp. natto GN=thyA PE=3 SV=1 2 288 1.0E-31
sp|P0CI79|TYSY1_BACSU Thymidylate synthase 1 OS=Bacillus subtilis (strain 168) GN=thyA1 PE=1 SV=1 2 288 7.0E-31
sp|O30394|TYSY_BACAT Thymidylate synthase (Fragment) OS=Bacillus atrophaeus GN=thyA PE=3 SV=1 50 288 1.0E-29
sp|O30397|TYSY1_BACAM Thymidylate synthase 1 (Fragment) OS=Bacillus amyloliquefaciens GN=thyA1 PE=3 SV=1 50 288 1.0E-29
sp|Q5R064|TYSY_IDILO Thymidylate synthase OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=thyA PE=3 SV=1 6 321 2.0E-28
sp|A8H1B4|TYSY_SHEPA Thymidylate synthase OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=thyA PE=3 SV=1 6 321 4.0E-28
sp|A5UI47|TYSY_HAEIG Thymidylate synthase OS=Haemophilus influenzae (strain PittGG) GN=thyA PE=3 SV=1 6 321 5.0E-28
sp|Q47Y31|TYSY_COLP3 Thymidylate synthase OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=thyA PE=3 SV=1 7 321 8.0E-28
sp|Q3IDN1|TYSY_PSEHT Thymidylate synthase OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=thyA PE=3 SV=1 6 321 8.0E-28
sp|C4LD19|TYSY_TOLAT Thymidylate synthase OS=Tolumonas auensis (strain DSM 9187 / TA4) GN=thyA PE=3 SV=1 6 321 9.0E-28
sp|Q59212|TYSY_BACLI Thymidylate synthase OS=Bacillus licheniformis GN=thyA PE=3 SV=1 50 288 2.0E-27
sp|Q65J44|TYSY_BACLD Thymidylate synthase OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=thyA PE=3 SV=1 50 288 2.0E-27
sp|Q4QM04|TYSY_HAEI8 Thymidylate synthase OS=Haemophilus influenzae (strain 86-028NP) GN=thyA PE=3 SV=1 6 321 2.0E-27
sp|Q9UWQ5|TYSY_HALVO Thymidylate synthase OS=Haloferax volcanii GN=hts PE=3 SV=1 8 276 2.0E-27
sp|P44420|TYSY_HAEIN Thymidylate synthase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=thyA PE=3 SV=1 6 321 3.0E-27
sp|A5UDH0|TYSY_HAEIE Thymidylate synthase OS=Haemophilus influenzae (strain PittEE) GN=thyA PE=3 SV=1 6 321 3.0E-27
sp|Q87SA0|TYSY_VIBPA Thymidylate synthase OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=thyA PE=3 SV=1 6 321 6.0E-27
sp|B0TIU4|TYSY_SHEHH Thymidylate synthase OS=Shewanella halifaxensis (strain HAW-EB4) GN=thyA PE=3 SV=1 6 321 8.0E-27
sp|B8CQK7|TYSY_SHEPW Thymidylate synthase OS=Shewanella piezotolerans (strain WP3 / JCM 13877) GN=thyA PE=3 SV=1 6 321 1.0E-26
sp|Q5E7P1|TYSY_VIBF1 Thymidylate synthase OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=thyA PE=3 SV=2 6 321 2.0E-26
sp|B0UWT7|TYSY_HISS2 Thymidylate synthase OS=Histophilus somni (strain 2336) GN=thyA PE=3 SV=1 6 321 2.0E-26
sp|Q0I563|TYSY_HAES1 Thymidylate synthase OS=Haemophilus somnus (strain 129Pt) GN=thyA PE=3 SV=1 6 321 2.0E-26
sp|A5F8Y6|TYSY_VIBC3 Thymidylate synthase OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=thyA PE=3 SV=1 6 321 3.0E-26
sp|C3LST0|TYSY_VIBCM Thymidylate synthase OS=Vibrio cholerae serotype O1 (strain M66-2) GN=thyA PE=3 SV=1 6 321 3.0E-26
sp|O66108|TYSY_VIBCH Thymidylate synthase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=thyA PE=3 SV=1 6 321 3.0E-26
sp|P57808|TYSY_PASMU Thymidylate synthase OS=Pasteurella multocida (strain Pm70) GN=thyA PE=3 SV=1 7 321 6.0E-26
sp|A8FSC3|TYSY_SHESH Thymidylate synthase OS=Shewanella sediminis (strain HAW-EB3) GN=thyA PE=3 SV=1 6 321 6.0E-26
sp|Q8DER9|TYSY_VIBVU Thymidylate synthase OS=Vibrio vulnificus (strain CMCP6) GN=thyA PE=3 SV=1 6 321 1.0E-25
sp|Q7MNN6|TYSY_VIBVY Thymidylate synthase OS=Vibrio vulnificus (strain YJ016) GN=thyA PE=3 SV=1 6 321 2.0E-25
sp|A7MXJ9|TYSY_VIBCB Thymidylate synthase OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=thyA PE=3 SV=1 6 321 4.0E-25
sp|A3QBR4|TYSY_SHELP Thymidylate synthase OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=thyA PE=3 SV=1 6 321 2.0E-24
sp|Q6LUM1|TYSY_PHOPR Thymidylate synthase OS=Photobacterium profundum GN=thyA PE=3 SV=1 6 321 3.0E-24
sp|A6VMA0|TYSY_ACTSZ Thymidylate synthase OS=Actinobacillus succinogenes (strain ATCC 55618 / 130Z) GN=thyA PE=3 SV=1 5 321 6.0E-24
sp|Q65VJ8|TYSY_MANSM Thymidylate synthase OS=Mannheimia succiniciproducens (strain MBEL55E) GN=thyA PE=3 SV=1 5 321 9.0E-24
sp|B7VJ78|TYSY_VIBTL Thymidylate synthase OS=Vibrio tasmaniensis (strain LGP32) GN=thyA PE=3 SV=1 6 321 1.0E-23
sp|A1SS96|TYSY_PSYIN Thymidylate synthase OS=Psychromonas ingrahamii (strain 37) GN=thyA PE=3 SV=1 6 321 3.0E-23
sp|Q15P51|TYSY_PSEA6 Thymidylate synthase OS=Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) GN=thyA PE=3 SV=1 6 321 9.0E-23
sp|A6W1R4|TYSY_MARMS Thymidylate synthase OS=Marinomonas sp. (strain MWYL1) GN=thyA PE=3 SV=1 6 321 3.0E-22
sp|Q07YY3|TYSY_SHEFN Thymidylate synthase OS=Shewanella frigidimarina (strain NCIMB 400) GN=thyA PE=3 SV=1 6 321 4.0E-21
sp|P0C0M4|TYSY_STAEP Thymidylate synthase (Fragment) OS=Staphylococcus epidermidis GN=thyA PE=3 SV=1 223 321 7.0E-20
sp|B8F6S2|TYSY_HAEPS Thymidylate synthase OS=Haemophilus parasuis serovar 5 (strain SH0165) GN=thyA PE=3 SV=1 6 321 2.0E-19
sp|Q8RGP6|TYSY_FUSNN Thymidylate synthase OS=Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131) GN=thyA PE=3 SV=1 52 321 1.0E-18
sp|Q7VMH2|TYSY_HAEDU Thymidylate synthase OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=thyA PE=3 SV=1 6 321 1.0E-16
sp|P19368|TYSY_LACLA Thymidylate synthase OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=thyA PE=3 SV=2 50 313 2.0E-13
sp|Q8DUI4|TYSY_STRMU Thymidylate synthase OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=thyA PE=3 SV=1 50 313 2.0E-12
sp|A4VUL1|TYSY_STRSY Thymidylate synthase OS=Streptococcus suis (strain 05ZYH33) GN=thyA PE=3 SV=1 50 313 5.0E-12
sp|A4W0V3|TYSY_STRS2 Thymidylate synthase OS=Streptococcus suis (strain 98HAH33) GN=thyA PE=3 SV=1 50 313 5.0E-12
sp|Q02Y43|TYSY_LACLS Thymidylate synthase OS=Lactococcus lactis subsp. cremoris (strain SK11) GN=thyA PE=3 SV=1 50 313 6.0E-12
sp|A3CMU9|TYSY_STRSV Thymidylate synthase OS=Streptococcus sanguinis (strain SK36) GN=thyA PE=3 SV=1 50 313 2.0E-11
sp|A8AXC2|TYSY_STRGC Thymidylate synthase OS=Streptococcus gordonii (strain Challis / ATCC 35105 / CH1 / DL1 / V288) GN=thyA PE=3 SV=1 50 313 2.0E-11
sp|Q8DZ07|TYSY_STRA5 Thymidylate synthase OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=thyA PE=3 SV=1 50 313 7.0E-11
sp|C1CQE7|TYSY_STRZT Thymidylate synthase OS=Streptococcus pneumoniae (strain Taiwan19F-14) GN=thyA PE=3 SV=1 50 313 1.0E-10
sp|C1CJD5|TYSY_STRZP Thymidylate synthase OS=Streptococcus pneumoniae (strain P1031) GN=thyA PE=3 SV=1 50 313 1.0E-10
sp|P67050|TYSY_STRR6 Thymidylate synthase OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=thyA PE=3 SV=1 50 313 1.0E-10
sp|P67049|TYSY_STRPN Thymidylate synthase OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=thyA PE=1 SV=1 50 313 1.0E-10
sp|C1C631|TYSY_STRP7 Thymidylate synthase OS=Streptococcus pneumoniae (strain 70585) GN=thyA PE=3 SV=1 50 313 1.0E-10
sp|Q04LL8|TYSY_STRP2 Thymidylate synthase OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=thyA PE=3 SV=1 50 313 1.0E-10
sp|C1CD36|TYSY_STRZJ Thymidylate synthase OS=Streptococcus pneumoniae (strain JJA) GN=thyA PE=3 SV=1 50 313 2.0E-10
sp|B8ZMQ1|TYSY_STRPJ Thymidylate synthase OS=Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1) GN=thyA PE=3 SV=1 50 313 2.0E-10
sp|Q8E4L6|TYSY_STRA3 Thymidylate synthase OS=Streptococcus agalactiae serotype III (strain NEM316) GN=thyA PE=3 SV=1 50 313 2.0E-10
sp|Q3K0J7|TYSY_STRA1 Thymidylate synthase OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=thyA PE=3 SV=1 50 313 2.0E-10
sp|Q48U25|TYSY_STRPM Thymidylate synthase OS=Streptococcus pyogenes serotype M28 (strain MGAS6180) GN=thyA PE=3 SV=2 50 313 3.0E-10
sp|A2RF20|TYSY_STRPG Thymidylate synthase OS=Streptococcus pyogenes serotype M5 (strain Manfredo) GN=thyA PE=3 SV=1 50 313 3.0E-10
sp|Q1J744|TYSY_STRPF Thymidylate synthase OS=Streptococcus pyogenes serotype M4 (strain MGAS10750) GN=thyA PE=3 SV=2 50 313 3.0E-10
sp|Q1JHC5|TYSY_STRPD Thymidylate synthase OS=Streptococcus pyogenes serotype M2 (strain MGAS10270) GN=thyA PE=3 SV=2 50 313 3.0E-10
sp|Q8P1D1|TYSY_STRP8 Thymidylate synthase OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=thyA PE=3 SV=1 50 313 3.0E-10
sp|Q5XCM3|TYSY_STRP6 Thymidylate synthase OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=thyA PE=3 SV=2 50 313 3.0E-10
sp|Q03LN3|TYSY_STRTD Thymidylate synthase OS=Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9) GN=thyA PE=3 SV=1 50 313 3.0E-10
sp|Q5M0S7|TYSY_STRT1 Thymidylate synthase OS=Streptococcus thermophilus (strain CNRZ 1066) GN=thyA PE=3 SV=1 50 313 3.0E-10
sp|Q1JM80|TYSY_STRPC Thymidylate synthase OS=Streptococcus pyogenes serotype M12 (strain MGAS9429) GN=thyA PE=3 SV=2 50 313 4.0E-10
sp|Q1JC96|TYSY_STRPB Thymidylate synthase OS=Streptococcus pyogenes serotype M12 (strain MGAS2096) GN=thyA PE=3 SV=2 50 313 4.0E-10
sp|Q5M5B3|TYSY_STRT2 Thymidylate synthase OS=Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311) GN=thyA PE=3 SV=1 50 313 7.0E-10
sp|P0DG67|TYSY_STRPQ Thymidylate synthase OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=thyA PE=3 SV=1 50 313 3.0E-09
sp|P0DG66|TYSY_STRP3 Thymidylate synthase OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=thyA PE=3 SV=1 50 313 3.0E-09
sp|P67051|TYSY_STRP1 Thymidylate synthase OS=Streptococcus pyogenes serotype M1 GN=thyA PE=3 SV=1 50 313 3.0E-09
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 66 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|7280
MQEEHQYLDLVREVLDQGEHRPDRTGTGTYSIFAPRPLKFLLNKDGIPILPLLTTKRVFLRAVVAELLWFIEGNT
SSLALSEAGVKIWDGNGSREFLDSVGLSHRELGDLGPVYGFQWRHFGAEYVDAKTDYTGKGVDQLADVIRKLRET
PYDRRIILSAWNPKDLKSMALPPCHMFAQFYVSYPRAKKSPTATNGHDEAALAEDGREEKPKGHLHCQLYQRSCD
MGLGVPFNIASYALLTHMLAHVCDLVPGSFTHVMGDAHVYIDHVEALKEQLERDPRDFPQLEIVREKGGSIDGWK
PEDFVVKGYNPHKSIPMKMSV*
Coding >Hirsu2|7280
ATGCAGGAAGAACATCAGTACCTCGACCTCGTGCGAGAGGTGCTCGATCAAGGAGAGCACCGACCTGATCGCACG
GGCACAGGCACCTATTCCATCTTTGCTCCACGGCCGCTGAAGTTCCTGCTAAACAAGGACGGCATACCGATCCTA
CCGCTTCTCACCACAAAACGGGTCTTCCTCAGGGCCGTCGTCGCCGAGCTCCTGTGGTTCATAGAAGGTAACACG
TCATCGCTTGCGCTGAGCGAGGCCGGCGTCAAGATCTGGGATGGAAACGGCTCGCGCGAGTTCCTCGACAGCGTA
GGCCTGTCGCACCGCGAGTTGGGCGACCTGGGCCCCGTATACGGCTTCCAATGGCGCCACTTCGGGGCCGAGTAT
GTCGACGCAAAGACCGACTACACGGGTAAGGGCGTGGATCAGCTCGCCGACGTGATACGAAAGCTACGCGAGACG
CCCTACGACCGCCGCATCATCCTGTCGGCTTGGAATCCGAAAGACCTTAAGAGCATGGCTTTACCGCCCTGTCAT
ATGTTCGCCCAATTTTACGTATCATATCCGCGGGCCAAGAAATCGCCGACGGCGACGAATGGCCACGATGAGGCT
GCCCTGGCCGAGGATGGGCGAGAGGAGAAACCCAAGGGCCATCTGCACTGCCAGCTGTACCAGAGGTCTTGCGAC
ATGGGGCTGGGCGTTCCATTCAACATCGCCAGCTATGCGCTTCTGACTCACATGTTGGCGCACGTCTGCGATTTG
GTTCCCGGAAGCTTCACACATGTCATGGGTGATGCGCACGTATACATTGATCACGTCGAAGCTCTTAAGGAGCAG
CTGGAGCGCGACCCGCGAGATTTCCCTCAACTTGAAATTGTGCGAGAAAAGGGCGGCAGCATCGACGGCTGGAAG
CCCGAAGACTTCGTGGTCAAGGGCTACAACCCCCATAAGTCCATCCCTATGAAGATGTCGGTGTAG
Transcript >Hirsu2|7280
ATGCAGGAAGAACATCAGTACCTCGACCTCGTGCGAGAGGTGCTCGATCAAGGAGAGCACCGACCTGATCGCACG
GGCACAGGCACCTATTCCATCTTTGCTCCACGGCCGCTGAAGTTCCTGCTAAACAAGGACGGCATACCGATCCTA
CCGCTTCTCACCACAAAACGGGTCTTCCTCAGGGCCGTCGTCGCCGAGCTCCTGTGGTTCATAGAAGGTAACACG
TCATCGCTTGCGCTGAGCGAGGCCGGCGTCAAGATCTGGGATGGAAACGGCTCGCGCGAGTTCCTCGACAGCGTA
GGCCTGTCGCACCGCGAGTTGGGCGACCTGGGCCCCGTATACGGCTTCCAATGGCGCCACTTCGGGGCCGAGTAT
GTCGACGCAAAGACCGACTACACGGGTAAGGGCGTGGATCAGCTCGCCGACGTGATACGAAAGCTACGCGAGACG
CCCTACGACCGCCGCATCATCCTGTCGGCTTGGAATCCGAAAGACCTTAAGAGCATGGCTTTACCGCCCTGTCAT
ATGTTCGCCCAATTTTACGTATCATATCCGCGGGCCAAGAAATCGCCGACGGCGACGAATGGCCACGATGAGGCT
GCCCTGGCCGAGGATGGGCGAGAGGAGAAACCCAAGGGCCATCTGCACTGCCAGCTGTACCAGAGGTCTTGCGAC
ATGGGGCTGGGCGTTCCATTCAACATCGCCAGCTATGCGCTTCTGACTCACATGTTGGCGCACGTCTGCGATTTG
GTTCCCGGAAGCTTCACACATGTCATGGGTGATGCGCACGTATACATTGATCACGTCGAAGCTCTTAAGGAGCAG
CTGGAGCGCGACCCGCGAGATTTCCCTCAACTTGAAATTGTGCGAGAAAAGGGCGGCAGCATCGACGGCTGGAAG
CCCGAAGACTTCGTGGTCAAGGGCTACAACCCCCATAAGTCCATCCCTATGAAGATGTCGGTGTAG
Gene >Hirsu2|7280
ATGCAGGAAGAACATCAGTACCTCGACCTCGTGCGAGAGGTGCTCGATCAAGGAGAGCACCGACCTGATCGGTAG
GCAGCCCCTCCAAGACCATTATCTAGCGAGAGGCGATTGCTGACGCTGCCGCAGCACGGGCACAGGCACCTATTC
CATCTTTGCTCCACGGCCGCTGAAGTTCCTGCTAAACAAGGACGGCATACCGATCCTACCGCTTCTCACCACAAA
ACGGGTCTTCCTCAGGGCCGTCGTCGCCGAGCTCCTGTGGTTCATAGAAGGTAACACGTCATCGCTTGCGCTGAG
CGAGGCCGGCGTCAAGATCTGGGATGGAAACGGCTCGCGCGAGTTCCTCGACAGCGTAGGCCTGTCGCACCGCGA
GTTGGGCGACCTGGGCCCCGTATACGGCTTCCAATGGCGCCACTTCGGGGCCGAGTATGTCGACGCAAAGACCGA
CTACACGGGTAAGGGCGTGGATCAGCTCGCCGACGTGATACGAAAGCTACGCGAGACGCCCTACGACCGCCGCAT
CATCCTGTCGGCTTGGAATCCGAAAGACCTTAAGAGCATGGCTTTACCGCCCTGTCATATGTTCGCCCAATTTTA
CGTATCATATCCGCGGGCCAAGAAATCGCCGACGGCGACGAATGGCCACGATGAGGCTGCCCTGGCCGAGGATGG
GCGAGAGGAGAAACCCAAGGGCCATCTGCACTGCCAGCTGTACCAGAGGTCTTGCGACATGGGGCTGGGCGTTCC
ATTCAACATCGCCAGCTATGCGCTTCTGACTCACATGTTGGCGCACGTCTGCGATTTGGTTCCCGGAAGCTTCAC
ACATGTCATGGGTGATGCGCACGTATACATTGATCACGTCGAAGCTCTTAAGGAGCAGCTGGAGCGCGACCCGCG
AGATTTCCCTCAACTTGAAATTGTGCGAGAAAAGGGCGGCAGCATCGACGGCTGGAAGCCCGAAGACTTCGTGGT
CAAGGGCTACAACCCCCATAAGTCCATCCCTATGAAGATGTCGGTGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail