Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|7271
Gene name
LocationContig_412:2495..4621
Strand-
Gene length (bp)2126
Transcript length (bp)1929
Coding sequence length (bp)1929
Protein length (aa) 643

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O60056|YG55_SCHPO Uncharacterized transcriptional regulatory protein C56F2.05c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC56F2.05c PE=3 SV=1 519 591 1.0E-13

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus Nuclear localization signal 0.315 0.9023 0.1928 0.0639 0.0699 0.0012 0.0309 0.0207 0.0095 0.0009

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup3726
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1631
Ophiocordyceps australis map64 (Brazil) OphauB2|5834
Ophiocordyceps camponoti-floridani Ophcf2|04851
Ophiocordyceps camponoti-rufipedis Ophun1|6379
Ophiocordyceps kimflemingae Ophio5|5509
Ophiocordyceps subramaniannii Hirsu2|7271 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|7271
MASMSPIDTCAVVSGPSSNGGSVSPRQTATPKNVAFELMFSNSPQYRARLPMRVQIYPHDTTDSIVTTVKNFYGL
YSGPTGSKGVSFEDDNGNTLIARYENFRNNMVVYVRVSEEPPAAFAPHPFHPAVIGPDPYYAAEGYPPQQPPRFD
QDIHRPSSRASRRRSPSPGAARGRRSGSASTTGKKGRSRSVKNRASVAHSHADAYSDSVNGYSSGDGAPSTASGK
NKEQLGNTDISVENIVEGGRRKRAKFESSELPLFAPPQMPAATSNPSVSPARRIEHPRPSLPFVHPGQNPFTNPR
PMQSPQNYNSVMAHAGMYATPASQGHRSRGSIGYASNGSGVATGLGVLPTPDPTVGSCMSEEDKDVAIQLMRLGE
SSNISHGRTSASTMDDTFSGRADIASSTGATSDGESDSEHEHPAPRRQKLDVSGGSRPIFETTEAHFIPTTESAD
VSADDADYEDGANSSIGEIKPLPAKKQPPVKHKAPSSLTSAAAKPAAAKPKAARPPSVKTKKQPASVAGPMSPAS
ITHSRKQSVASTGYVPQSGEEDQPDLSTKPRCQRCRKSKKGCDRQRPCGRCRDAGLSADQCISEDEGNGRKGRYG
RHMGVPIKKEETAVLPVPPALLPAAPITTAAMTADKAKKRKR*
Coding >Hirsu2|7271
ATGGCCTCCATGTCGCCGATAGACACTTGTGCCGTCGTGTCCGGCCCCTCCTCCAATGGAGGCAGTGTCTCGCCG
CGGCAGACGGCGACGCCCAAGAACGTCGCATTCGAGTTGATGTTTTCCAACTCGCCGCAATACCGCGCGCGCCTG
CCCATGCGGGTGCAGATCTATCCCCATGACACCACCGACTCGATTGTGACGACGGTCAAGAATTTTTACGGCCTC
TACTCGGGCCCGACCGGCTCCAAGGGCGTCAGCTTCGAGGACGACAACGGCAACACGCTCATTGCGCGCTACGAG
AACTTTCGCAACAACATGGTCGTCTACGTCCGGGTGAGCGAGGAGCCACCGGCCGCCTTCGCGCCGCATCCCTTC
CATCCCGCCGTCATCGGGCCCGACCCCTACTACGCTGCCGAGGGCTACCCGCCCCAACAGCCACCGCGCTTTGAT
CAGGATATCCACAGGCCCAGCTCCCGGGCGTCGCGCAGGCGCAGCCCTTCCCCCGGCGCCGCCCGCGGCCGGCGC
AGCGGCTCCGCGAGCACCACCGGCAAGAAAGGGCGCTCTCGGTCTGTCAAGAACAGGGCGTCCGTGGCCCACAGC
CATGCCGACGCCTACAGCGACAGCGTCAATGGGTATAGCAGCGGCGACGGCGCCCCCAGCACCGCCTCGGGCAAG
AACAAGGAACAGCTGGGCAACACCGACATCAGCGTCGAGAACATCGTCGAGGGCGGTCGGCGCAAGAGGGCCAAA
TTTGAGAGCTCGGAGTTGCCGCTGTTCGCGCCGCCGCAGATGCCCGCGGCCACGTCGAATCCTTCCGTCTCCCCC
GCTCGTCGGATCGAGCATCCGCGTCCGTCTTTGCCATTTGTTCATCCGGGACAAAACCCCTTCACGAACCCACGT
CCGATGCAGTCGCCCCAAAACTACAATAGTGTCATGGCCCACGCCGGCATGTACGCCACCCCCGCGTCCCAGGGC
CACCGCTCGCGCGGCAGCATCGGCTACGCCAGCAATGGGAGCGGCGTAGCCACGGGCCTGGGCGTCCTCCCCACC
CCCGACCCGACCGTCGGCAGCTGCATGTCGGAGGAGGACAAGGACGTGGCCATCCAGCTGATGAGACTGGGCGAG
TCGTCCAACATCTCGCACGGCCGGACCTCGGCCTCCACCATGGACGACACCTTCAGCGGCAGAGCCGACATCGCC
TCGTCCACCGGCGCCACCAGCGACGGCGAGAGCGACAGTGAGCACGAGCATCCGGCGCCGCGCCGCCAGAAGCTC
GACGTGAGCGGCGGCAGCCGGCCCATTTTCGAGACGACGGAGGCACACTTCATCCCGACGACGGAGAGCGCCGAC
GTCAGTGCCGACGACGCCGACTACGAAGACGGCGCCAACAGCTCCATCGGAGAGATCAAGCCGCTGCCGGCCAAG
AAGCAGCCCCCCGTCAAGCACAAGGCGCCGTCGTCGCTGACATCGGCGGCAGCGAAGCCGGCGGCGGCAAAGCCC
AAGGCCGCGCGGCCGCCCAGCGTCAAGACGAAGAAGCAGCCGGCGTCCGTGGCCGGACCCATGTCGCCGGCCTCG
ATCACGCACTCGCGGAAGCAGTCAGTCGCCTCTACCGGGTACGTGCCCCAGTCCGGCGAGGAGGACCAGCCGGAC
CTGTCGACCAAGCCCCGCTGCCAGCGGTGCCGCAAGAGCAAGAAGGGCTGCGACCGCCAGCGCCCGTGCGGCCGC
TGCCGCGACGCCGGCCTGTCGGCCGATCAGTGCATCAGCGAGGACGAGGGCAACGGCCGCAAGGGACGATACGGT
CGTCACATGGGAGTCCCGATCAAGAAGGAGGAGACTGCCGTCCTCCCGGTCCCGCCGGCCCTGCTGCCCGCTGCC
CCCATCACCACGGCGGCCATGACGGCCGACAAGGCGAAAAAGCGGAAGCGATAG
Transcript >Hirsu2|7271
ATGGCCTCCATGTCGCCGATAGACACTTGTGCCGTCGTGTCCGGCCCCTCCTCCAATGGAGGCAGTGTCTCGCCG
CGGCAGACGGCGACGCCCAAGAACGTCGCATTCGAGTTGATGTTTTCCAACTCGCCGCAATACCGCGCGCGCCTG
CCCATGCGGGTGCAGATCTATCCCCATGACACCACCGACTCGATTGTGACGACGGTCAAGAATTTTTACGGCCTC
TACTCGGGCCCGACCGGCTCCAAGGGCGTCAGCTTCGAGGACGACAACGGCAACACGCTCATTGCGCGCTACGAG
AACTTTCGCAACAACATGGTCGTCTACGTCCGGGTGAGCGAGGAGCCACCGGCCGCCTTCGCGCCGCATCCCTTC
CATCCCGCCGTCATCGGGCCCGACCCCTACTACGCTGCCGAGGGCTACCCGCCCCAACAGCCACCGCGCTTTGAT
CAGGATATCCACAGGCCCAGCTCCCGGGCGTCGCGCAGGCGCAGCCCTTCCCCCGGCGCCGCCCGCGGCCGGCGC
AGCGGCTCCGCGAGCACCACCGGCAAGAAAGGGCGCTCTCGGTCTGTCAAGAACAGGGCGTCCGTGGCCCACAGC
CATGCCGACGCCTACAGCGACAGCGTCAATGGGTATAGCAGCGGCGACGGCGCCCCCAGCACCGCCTCGGGCAAG
AACAAGGAACAGCTGGGCAACACCGACATCAGCGTCGAGAACATCGTCGAGGGCGGTCGGCGCAAGAGGGCCAAA
TTTGAGAGCTCGGAGTTGCCGCTGTTCGCGCCGCCGCAGATGCCCGCGGCCACGTCGAATCCTTCCGTCTCCCCC
GCTCGTCGGATCGAGCATCCGCGTCCGTCTTTGCCATTTGTTCATCCGGGACAAAACCCCTTCACGAACCCACGT
CCGATGCAGTCGCCCCAAAACTACAATAGTGTCATGGCCCACGCCGGCATGTACGCCACCCCCGCGTCCCAGGGC
CACCGCTCGCGCGGCAGCATCGGCTACGCCAGCAATGGGAGCGGCGTAGCCACGGGCCTGGGCGTCCTCCCCACC
CCCGACCCGACCGTCGGCAGCTGCATGTCGGAGGAGGACAAGGACGTGGCCATCCAGCTGATGAGACTGGGCGAG
TCGTCCAACATCTCGCACGGCCGGACCTCGGCCTCCACCATGGACGACACCTTCAGCGGCAGAGCCGACATCGCC
TCGTCCACCGGCGCCACCAGCGACGGCGAGAGCGACAGTGAGCACGAGCATCCGGCGCCGCGCCGCCAGAAGCTC
GACGTGAGCGGCGGCAGCCGGCCCATTTTCGAGACGACGGAGGCACACTTCATCCCGACGACGGAGAGCGCCGAC
GTCAGTGCCGACGACGCCGACTACGAAGACGGCGCCAACAGCTCCATCGGAGAGATCAAGCCGCTGCCGGCCAAG
AAGCAGCCCCCCGTCAAGCACAAGGCGCCGTCGTCGCTGACATCGGCGGCAGCGAAGCCGGCGGCGGCAAAGCCC
AAGGCCGCGCGGCCGCCCAGCGTCAAGACGAAGAAGCAGCCGGCGTCCGTGGCCGGACCCATGTCGCCGGCCTCG
ATCACGCACTCGCGGAAGCAGTCAGTCGCCTCTACCGGGTACGTGCCCCAGTCCGGCGAGGAGGACCAGCCGGAC
CTGTCGACCAAGCCCCGCTGCCAGCGGTGCCGCAAGAGCAAGAAGGGCTGCGACCGCCAGCGCCCGTGCGGCCGC
TGCCGCGACGCCGGCCTGTCGGCCGATCAGTGCATCAGCGAGGACGAGGGCAACGGCCGCAAGGGACGATACGGT
CGTCACATGGGAGTCCCGATCAAGAAGGAGGAGACTGCCGTCCTCCCGGTCCCGCCGGCCCTGCTGCCCGCTGCC
CCCATCACCACGGCGGCCATGACGGCCGACAAGGCGAAAAAGCGGAAGCGATAG
Gene >Hirsu2|7271
ATGGCCTCCATGTCGCCGATAGACACTTGTGCCGTCGTGTCCGGCCCCTCCTCCAATGGAGGCAGTGTCTCGCCG
CGGCAGACGGCGACGCCCAAGAACGTCGCATTCGAGTTGATGTTTTCCAACTCGCCGCAATACCGCGCGCGCCTG
CCCATGCGGGTGCAGATCTATCCCCATGACACCACCGACTCGATTGTGACGACGGTCAAGAATTTTTACGGCCTC
TACTCGGGCCCGACCGGCTCCAAGGGCGTCAGCTTCGAGGACGACAACGGCAACACGCTCATTGCGCGCTACGAG
AACTTTCGCAACAACATGGTCGTCTACGTCCGGGTGAGCGAGGAGCCACCGGCCGCCTTCGCGCCGCATCCCTTC
CATCCCGCCGTCATCGGGCCCGACCCCTACTACGCTGCCGAGGGCTACCCGCCCCAACAGCCACCGCGCTTTGAT
CAGGATATCCACAGGCCCAGCTCCCGGGCGTCGCGCAGGCGCAGCCCTTCCCCCGGCGCCGCCCGCGGCCGGCGC
AGCGGCTCCGCGAGCACCACCGGCAAGAAAGGGCGCTCTCGGTCTGTCAAGAACAGGGCGTCCGTGGCCCACAGC
CATGCCGACGCCTACAGCGACAGCGTCAATGGGTATAGCAGCGGCGACGGCGCCCCCAGCACCGCCTCGGGCAAG
AACAAGGAACAGCTGGGCAACACCGACATCAGCGTCGAGAACATCGTCGAGGGCGGTCGGCGCAAGAGGGCCAAA
TTTGAGAGCTCGGTACGCAGCCTTGACTGTTCCCCTCCCACCCCTTTCCTCTCCTTTCCTCTTTCTCGTTGCCCC
GTGCCTCCCTCCTCCTGGCCCGCCCACCGTCACCGGACACCGCCGTCTGCAGCTGGGACGGCGGGGAACAGAAGC
CTACCGCGAGAAGATGCGGTTTGCCGCCCATTCGCTTCACACGCTGACCATGGCTCAAGGAGTTGCCGCTGTTCG
CGCCGCCGCAGATGCCCGCGGCCACGTCGAATCCTTCCGTCTCCCCCGCTCGTCGGATCGAGCATCCGCGTCCGT
CTTTGCCATTTGTTCATCCGGGACAAAACCCCTTCACGAACCCACGTCCGATGCAGTCGCCCCAAAACTACAATA
GTGTCATGGCCCACGCCGGCATGTACGCCACCCCCGCGTCCCAGGGCCACCGCTCGCGCGGCAGCATCGGCTACG
CCAGCAATGGGAGCGGCGTAGCCACGGGCCTGGGCGTCCTCCCCACCCCCGACCCGACCGTCGGCAGCTGCATGT
CGGAGGAGGACAAGGACGTGGCCATCCAGCTGATGAGACTGGGCGAGTCGTCCAACATCTCGCACGGCCGGACCT
CGGCCTCCACCATGGACGACACCTTCAGCGGCAGAGCCGACATCGCCTCGTCCACCGGCGCCACCAGCGACGGCG
AGAGCGACAGTGAGCACGAGCATCCGGCGCCGCGCCGCCAGAAGCTCGACGTGAGCGGCGGCAGCCGGCCCATTT
TCGAGACGACGGAGGCACACTTCATCCCGACGACGGAGAGCGCCGACGTCAGTGCCGACGACGCCGACTACGAAG
ACGGCGCCAACAGCTCCATCGGAGAGATCAAGCCGCTGCCGGCCAAGAAGCAGCCCCCCGTCAAGCACAAGGCGC
CGTCGTCGCTGACATCGGCGGCAGCGAAGCCGGCGGCGGCAAAGCCCAAGGCCGCGCGGCCGCCCAGCGTCAAGA
CGAAGAAGCAGCCGGCGTCCGTGGCCGGACCCATGTCGCCGGCCTCGATCACGCACTCGCGGAAGCAGTCAGTCG
CCTCTACCGGGTACGTGCCCCAGTCCGGCGAGGAGGACCAGCCGGACCTGTCGACCAAGCCCCGCTGCCAGCGGT
GCCGCAAGAGCAAGAAGGGCTGCGACCGCCAGCGCCCGTGCGGCCGCTGCCGCGACGCCGGCCTGTCGGCCGATC
AGTGCATCAGCGAGGACGAGGGCAACGGCCGCAAGGGACGATACGGTCGTCACATGGGAGTCCCGATCAAGAAGG
AGGAGACTGCCGTCCTCCCGGTCCCGCCGGCCCTGCTGCCCGCTGCCCCCATCACCACGGCGGCCATGACGGCCG
ACAAGGCGAAAAAGCGGAAGCGATAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail