Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|7262
Gene name
LocationContig_411:906..1372
Strand-
Gene length (bp)466
Transcript length (bp)408
Coding sequence length (bp)408
Protein length (aa) 136

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Extracellular Signal peptide 0.077 0.0413 0.9497 0.0772 0.0836 0.0066 0.0788 0.1309 0.0573 0.0018

SignalP

SignalP signal predicted Location Score
Yes 1 - 17 0.999773

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup132
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4594
Ophiocordyceps australis map64 (Brazil) OphauB2|8119
Ophiocordyceps camponoti-floridani Ophcf2|02435
Ophiocordyceps camponoti-rufipedis Ophun1|4175
Ophiocordyceps kimflemingae Ophio5|7212
Ophiocordyceps kimflemingae Ophio5|7535
Ophiocordyceps kimflemingae Ophio5|7863
Ophiocordyceps subramaniannii Hirsu2|1066
Ophiocordyceps subramaniannii Hirsu2|2840
Ophiocordyceps subramaniannii Hirsu2|5867
Ophiocordyceps subramaniannii Hirsu2|7262 (this protein)
Ophiocordyceps subramaniannii Hirsu2|9763

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|7262
MKFTIVSAVLLAGIANAAFDLEEYRKEVGRGGFDISGIIKKATCALPCVEEAAEHVPCSGSNLVESACNSIDKIK
VKSERCVLKCGVDKDIIEFVAKGAHALCKGRKGGLGGGLGGGRGEGGRGGEGGRGGYGGY*
Coding >Hirsu2|7262
ATGAAGTTCACCATCGTCTCCGCCGTCCTCCTCGCTGGCATTGCCAACGCTGCCTTCGACCTCGAGGAGTACCGC
AAGGAGGTCGGCCGCGGCGGCTTCGACATCTCGGGCATCATCAAGAAGGCCACCTGCGCGCTCCCCTGCGTCGAG
GAGGCCGCTGAGCACGTCCCCTGCTCCGGCTCCAACCTGGTCGAGAGCGCGTGCAACAGCATCGACAAGATCAAG
GTCAAGTCGGAGCGCTGCGTCCTCAAGTGCGGTGTCGACAAGGACATCATCGAGTTCGTTGCCAAGGGCGCCCAC
GCTCTCTGCAAGGGCCGCAAGGGTGGCCTCGGCGGTGGCCTCGGCGGTGGCCGTGGCGAGGGCGGCCGTGGCGGT
GAGGGTGGCCGTGGCGGCTACGGCGGCTACTAA
Transcript >Hirsu2|7262
ATGAAGTTCACCATCGTCTCCGCCGTCCTCCTCGCTGGCATTGCCAACGCTGCCTTCGACCTCGAGGAGTACCGC
AAGGAGGTCGGCCGCGGCGGCTTCGACATCTCGGGCATCATCAAGAAGGCCACCTGCGCGCTCCCCTGCGTCGAG
GAGGCCGCTGAGCACGTCCCCTGCTCCGGCTCCAACCTGGTCGAGAGCGCGTGCAACAGCATCGACAAGATCAAG
GTCAAGTCGGAGCGCTGCGTCCTCAAGTGCGGTGTCGACAAGGACATCATCGAGTTCGTTGCCAAGGGCGCCCAC
GCTCTCTGCAAGGGCCGCAAGGGTGGCCTCGGCGGTGGCCTCGGCGGTGGCCGTGGCGAGGGCGGCCGTGGCGGT
GAGGGTGGCCGTGGCGGCTACGGCGGCTACTAA
Gene >Hirsu2|7262
ATGAAGTTCACCATCGTCTCCGCCGTCCTCCTCGCTGGCATTGCCAACGCTGCCTTCGACCTCGAGGAGTACCGC
AAGGAGGTCGGCCGCGGCGGCTTCGACATCTCGGGCATCATCAAGAAGGCCACCTGCGCGCTCCCCTGCGTCGAG
GAGGCCGCTGAGCACGTCCCCTGCTCCGGCTCCAACCTGGTCGAGAGCGCGTGCAACAGCATCGACAAGATCAAG
GTCAAGTCGGAGCGCTGCGTCCTCAAGTGCGGTGTCGACAAGGACATCATCGGTAAGCAGCAACCCTGACCTGGT
TAAAACGTTACCCAAGCTGACGCGACGATGAACAGAGTTCGTTGCCAAGGGCGCCCACGCTCTCTGCAAGGGCCG
CAAGGGTGGCCTCGGCGGTGGCCTCGGCGGTGGCCGTGGCGAGGGCGGCCGTGGCGGTGAGGGTGGCCGTGGCGG
CTACGGCGGCTACTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail