Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|7250
Gene name
LocationContig_41:46956..48626
Strand-
Gene length (bp)1670
Transcript length (bp)1533
Coding sequence length (bp)1533
Protein length (aa) 511

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF11374 DUF3176 Protein of unknown function (DUF3176) 7.7E-19 2 93

Swissprot hits

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cell membrane|Lysosome/Vacuole Signal peptide|Transmembrane domain 0.1349 0.0667 0.0858 0.667 0.0474 0.0056 0.2018 0.6983 0.5816 0.0046

SignalP

(None)

Transmembrane Domains

Domain # Start End Length
1 405 427 22

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup6731
Change Orthofinder run
Species Protein ID
Ophiocordyceps camponoti-rufipedis Ophun1|6551
Ophiocordyceps kimflemingae Ophio5|8593
Ophiocordyceps subramaniannii Hirsu2|7250 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|7250
MIVIAIMTLVRVALGSIVESCICQGAWIWVSKSHQIRTRNRARLEDFKLFDEASRGFLGSLSLLWRLKGLHLSCI
GALIIIVTHGFETFSQQMFVYVQRPTVYINETSRPAPTPFRSDYWDNVVHRGFQDVYSLALSTKSAVYSGILAAQ
VRDLEPQCHTANCSWPVLPTLAVCGRCVPAPVKVDCMEDTRSCTFSVSPNTNATLPEAAELDIFKVNPVNGSLDA
SGHKKAYLSMFEIMTISKRATATHTSAAQCALWFCLKAYNISVADGRSQQTLVRTWDESRFEAATSAHSDEHVFL
GIPDIMNTQPKSRYSVSDRSLKALRAFFDSLTSGIFEHVSEVVNFSSDWIEAMWRATADLDSWIEKLSHSLTNEV
REHGTIRDPYKTDYEGSASKLASYVHVKWYWMIYPALFLTISLYYLVATIIAGARDNVSAWKGDSLPMLFSRIDP
RILAMGSKKMDVPKGLDDLGKSKVALAKNNDGYWTFEPHDSGREQDEEDNNLVLGALEYL*
Coding >Hirsu2|7250
ATGATCGTCATTGCCATTATGACGCTGGTCCGGGTCGCTCTCGGGAGTATCGTCGAGTCTTGCATCTGCCAGGGT
GCCTGGATCTGGGTCTCCAAATCGCACCAGATTCGGACGCGCAACCGAGCGCGGCTCGAGGACTTCAAGCTGTTT
GACGAAGCATCTCGGGGCTTTCTAGGCAGTCTCTCATTACTCTGGCGCCTGAAGGGACTACATCTATCGTGTATC
GGGGCCCTCATAATCATCGTGACGCATGGGTTTGAGACGTTTTCGCAGCAGATGTTTGTGTACGTCCAACGACCA
ACCGTCTATATCAACGAAACATCCCGACCAGCCCCTACCCCTTTCCGGAGCGACTACTGGGACAACGTCGTCCAC
CGGGGATTTCAAGATGTGTATTCCCTTGCCCTGTCGACCAAGTCAGCCGTATATAGCGGAATTCTGGCCGCGCAG
GTTCGCGACCTCGAGCCCCAATGCCACACGGCCAACTGCAGCTGGCCTGTCTTGCCGACCCTCGCAGTTTGCGGC
CGGTGCGTCCCCGCCCCGGTCAAAGTTGATTGCATGGAAGATACACGGTCCTGCACGTTCAGTGTCTCGCCCAAC
ACAAACGCCACGCTCCCCGAGGCTGCCGAGCTGGACATTTTCAAGGTGAATCCAGTGAATGGAAGTCTCGACGCC
TCAGGTCACAAGAAAGCGTATTTGTCGATGTTTGAAATCATGACGATATCGAAACGGGCAACTGCGACGCACACG
TCTGCGGCCCAATGTGCTCTATGGTTCTGCCTCAAGGCTTACAACATTTCTGTTGCCGACGGCCGGTCGCAGCAA
ACCCTGGTGAGGACGTGGGACGAGAGCCGGTTCGAGGCCGCGACAAGCGCTCACTCCGACGAGCACGTCTTTCTC
GGCATCCCTGACATCATGAATACACAGCCGAAATCTCGCTACAGTGTTTCCGACCGCTCTCTAAAAGCCTTGCGT
GCCTTTTTCGATTCTCTGACGAGCGGGATATTTGAACATGTCTCTGAGGTTGTCAACTTCTCATCTGACTGGATT
GAGGCAATGTGGCGGGCGACGGCAGACCTGGACAGCTGGATTGAAAAGCTGAGCCACAGCCTGACAAACGAGGTC
CGCGAGCACGGGACGATTCGCGACCCGTACAAAACAGATTACGAGGGAAGCGCGTCTAAACTGGCCAGCTATGTC
CACGTGAAGTGGTACTGGATGATTTATCCGGCCCTATTCCTGACCATAAGTCTCTATTACCTTGTTGCCACCATC
ATCGCCGGGGCTCGGGATAACGTCTCGGCTTGGAAGGGGGACTCTTTGCCCATGCTTTTCAGTCGTATCGACCCT
CGAATCCTGGCCATGGGGTCTAAAAAGATGGACGTACCCAAAGGGCTGGACGACCTCGGAAAGTCCAAGGTGGCT
CTGGCCAAGAACAATGATGGATACTGGACATTTGAGCCCCACGACTCCGGGAGGGAGCAGGACGAAGAAGACAAC
AACCTCGTTCTTGGAGCGCTGGAGTACTTGTGA
Transcript >Hirsu2|7250
ATGATCGTCATTGCCATTATGACGCTGGTCCGGGTCGCTCTCGGGAGTATCGTCGAGTCTTGCATCTGCCAGGGT
GCCTGGATCTGGGTCTCCAAATCGCACCAGATTCGGACGCGCAACCGAGCGCGGCTCGAGGACTTCAAGCTGTTT
GACGAAGCATCTCGGGGCTTTCTAGGCAGTCTCTCATTACTCTGGCGCCTGAAGGGACTACATCTATCGTGTATC
GGGGCCCTCATAATCATCGTGACGCATGGGTTTGAGACGTTTTCGCAGCAGATGTTTGTGTACGTCCAACGACCA
ACCGTCTATATCAACGAAACATCCCGACCAGCCCCTACCCCTTTCCGGAGCGACTACTGGGACAACGTCGTCCAC
CGGGGATTTCAAGATGTGTATTCCCTTGCCCTGTCGACCAAGTCAGCCGTATATAGCGGAATTCTGGCCGCGCAG
GTTCGCGACCTCGAGCCCCAATGCCACACGGCCAACTGCAGCTGGCCTGTCTTGCCGACCCTCGCAGTTTGCGGC
CGGTGCGTCCCCGCCCCGGTCAAAGTTGATTGCATGGAAGATACACGGTCCTGCACGTTCAGTGTCTCGCCCAAC
ACAAACGCCACGCTCCCCGAGGCTGCCGAGCTGGACATTTTCAAGGTGAATCCAGTGAATGGAAGTCTCGACGCC
TCAGGTCACAAGAAAGCGTATTTGTCGATGTTTGAAATCATGACGATATCGAAACGGGCAACTGCGACGCACACG
TCTGCGGCCCAATGTGCTCTATGGTTCTGCCTCAAGGCTTACAACATTTCTGTTGCCGACGGCCGGTCGCAGCAA
ACCCTGGTGAGGACGTGGGACGAGAGCCGGTTCGAGGCCGCGACAAGCGCTCACTCCGACGAGCACGTCTTTCTC
GGCATCCCTGACATCATGAATACACAGCCGAAATCTCGCTACAGTGTTTCCGACCGCTCTCTAAAAGCCTTGCGT
GCCTTTTTCGATTCTCTGACGAGCGGGATATTTGAACATGTCTCTGAGGTTGTCAACTTCTCATCTGACTGGATT
GAGGCAATGTGGCGGGCGACGGCAGACCTGGACAGCTGGATTGAAAAGCTGAGCCACAGCCTGACAAACGAGGTC
CGCGAGCACGGGACGATTCGCGACCCGTACAAAACAGATTACGAGGGAAGCGCGTCTAAACTGGCCAGCTATGTC
CACGTGAAGTGGTACTGGATGATTTATCCGGCCCTATTCCTGACCATAAGTCTCTATTACCTTGTTGCCACCATC
ATCGCCGGGGCTCGGGATAACGTCTCGGCTTGGAAGGGGGACTCTTTGCCCATGCTTTTCAGTCGTATCGACCCT
CGAATCCTGGCCATGGGGTCTAAAAAGATGGACGTACCCAAAGGGCTGGACGACCTCGGAAAGTCCAAGGTGGCT
CTGGCCAAGAACAATGATGGATACTGGACATTTGAGCCCCACGACTCCGGGAGGGAGCAGGACGAAGAAGACAAC
AACCTCGTTCTTGGAGCGCTGGAGTACTTGTGA
Gene >Hirsu2|7250
ATGATCGTCATTGCCATTATGACGCTGGTCCGGGTCGCTCTCGGGAGTATCGTCGAGTCTTGCATCTGCCAGGGT
GCCTGGATCTGGGTCTCCAAATCGCACCAGATTCGGACGCGCAACCGAGCGCGGCTCGAGGACTTCAAGCTGTTT
GACGAAGCATCTCGGGGCTTTCTAGGCAGTCTCTCATTACTCTGGCGCCTGAAGGGACTGTTAGTCTCCCTTCTC
CTGTTCGAACTCTCAACTCATAAACCACTCCCGTCTCTGACACAAACTGTCTCGCAGACATCTATCGTGTATCGG
GGCCCTCATAATCATCGTGACGCATGGGTTTGAGACGTTTTCGCAGCAGATGTTTGTGTACGTCCAACGACCAAC
CGTCTATATCAACGAAACATCCCGACCAGCCCCTACCCCTTTCCGGAGCGACTACTGGGACAACGTCGTCCACCG
GGGATTTCAAGATGGTACTGTCTCTGCAATCTGCCTACTTGGCACGGGCCGTTCGATGTTGATTCGTGTTGCTGC
TAGTGTATTCCCTTGCCCTGTCGACCAAGTCAGCCGTATATAGCGGAATTCTGGCCGCGCAGGTTCGCGACCTCG
AGCCCCAATGCCACACGGCCAACTGCAGCTGGCCTGTCTTGCCGACCCTCGCAGTTTGCGGCCGGTGCGTCCCCG
CCCCGGTCAAAGTTGATTGCATGGAAGATACACGGTCCTGCACGTTCAGTGTCTCGCCCAACACAAACGCCACGC
TCCCCGAGGCTGCCGAGCTGGACATTTTCAAGGTGAATCCAGTGAATGGAAGTCTCGACGCCTCAGGTCACAAGA
AAGCGTATTTGTCGATGTTTGAAATCATGACGATATCGAAACGGGCAACTGCGACGCACACGTCTGCGGCCCAAT
GTGCTCTATGGTTCTGCCTCAAGGCTTACAACATTTCTGTTGCCGACGGCCGGTCGCAGCAAACCCTGGTGAGGA
CGTGGGACGAGAGCCGGTTCGAGGCCGCGACAAGCGCTCACTCCGACGAGCACGTCTTTCTCGGCATCCCTGACA
TCATGAATACACAGCCGAAATCTCGCTACAGTGTTTCCGACCGCTCTCTAAAAGCCTTGCGTGCCTTTTTCGATT
CTCTGACGAGCGGGATATTTGAACATGTCTCTGAGGTTGTCAACTTCTCATCTGACTGGATTGAGGCAATGTGGC
GGGCGACGGCAGACCTGGACAGCTGGATTGAAAAGCTGAGCCACAGCCTGACAAACGAGGTCCGCGAGCACGGGA
CGATTCGCGACCCGTACAAAACAGATTACGAGGGAAGCGCGTCTAAACTGGCCAGCTATGTCCACGTGAAGTGGT
ACTGGATGATTTATCCGGCCCTATTCCTGACCATAAGTCTCTATTACCTTGTTGCCACCATCATCGCCGGGGCTC
GGGATAACGTCTCGGCTTGGAAGGGGGACTCTTTGCCCATGCTTTTCAGTCGTATCGACCCTCGAATCCTGGCCA
TGGGGTCTAAAAAGATGGACGTACCCAAAGGGCTGGACGACCTCGGAAAGTCCAAGGTGGCTCTGGCCAAGAACA
ATGATGGATACTGGACATTTGAGCCCCACGACTCCGGGAGGGAGCAGGACGAAGAAGACAACAACCTCGTTCTTG
GAGCGCTGGAGTACTTGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail