Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|7249
Gene name
LocationContig_41:45162..46120
Strand+
Gene length (bp)958
Transcript length (bp)840
Coding sequence length (bp)840
Protein length (aa) 280

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00856 SET SET domain 7.0E-08 119 245

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O74467|SET5_SCHPO SET domain-containing protein 5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=set5 PE=1 SV=1 105 267 2.0E-07

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0003674 molecular_function No
GO:0005488 binding No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Plastid 0.4154 0.3612 0.3378 0.0536 0.4908 0.554 0.0957 0.0863 0.093 0.1921

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup6237
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis map64 (Brazil) OphauB2|1978
Ophiocordyceps camponoti-floridani Ophcf2|03252
Ophiocordyceps kimflemingae Ophio5|708
Ophiocordyceps subramaniannii Hirsu2|7249 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|7249
MAVHLQPHPADIYSRTVQALLHPFSFPRGLARPKCRLRARSLIADKPVISPHASYLSAPSVAFNADDRRDAQCRV
FGPDAEASPGAAAELSPRPCAYTVPAEPRFRNDCFEVALTSAEGWGAFATRKLRRGDVILCEKPLFIADKRSLFQ
EFDRLGPQARRLALGLHANELAKPGTPPIQNIWETNCFTVGGQQAGLFLIASRFNHACYPANNVKFHFDAERASI
VLRVRADEIPVGQELRISYGRGRHALDLYTTYGFRCRCYVCTGSDESDIVSQQW*
Coding >Hirsu2|7249
ATGGCGGTTCATCTTCAGCCTCATCCTGCCGACATCTATTCACGCACGGTTCAGGCCTTGCTTCACCCATTCTCG
TTTCCTCGCGGCTTGGCCAGGCCCAAGTGCCGCCTTCGCGCCAGGTCTTTGATCGCGGACAAGCCTGTGATCTCT
CCCCATGCCTCTTACCTGTCCGCGCCCAGCGTCGCCTTCAACGCAGACGATCGTCGCGACGCCCAATGCCGCGTC
TTCGGCCCCGACGCCGAGGCCAGCCCGGGAGCCGCCGCCGAGCTCTCCCCCCGACCATGTGCTTATACGGTACCG
GCAGAGCCCCGTTTCCGCAACGACTGCTTCGAGGTCGCCCTGACCAGCGCCGAGGGCTGGGGCGCTTTTGCGACC
AGGAAACTGCGCCGCGGCGATGTCATCTTGTGCGAAAAGCCGCTCTTCATCGCTGACAAGCGGAGCCTATTCCAG
GAATTCGACAGACTCGGCCCGCAGGCTAGGCGCCTGGCCCTGGGTCTTCACGCCAATGAGTTGGCCAAGCCGGGA
ACGCCCCCGATCCAAAACATCTGGGAAACCAACTGTTTCACAGTGGGAGGACAGCAAGCCGGGCTTTTCCTGATC
GCATCCCGCTTCAACCATGCCTGTTACCCGGCCAACAACGTCAAGTTCCACTTCGACGCCGAAAGAGCCAGCATC
GTCCTCCGTGTTCGAGCTGACGAGATTCCAGTGGGTCAAGAGTTGCGAATATCGTATGGAAGGGGCCGCCACGCT
CTCGACCTGTACACGACGTACGGCTTTCGATGCCGATGTTATGTGTGCACGGGCTCAGACGAAAGCGACATCGTG
TCCCAGCAGTGGTGA
Transcript >Hirsu2|7249
ATGGCGGTTCATCTTCAGCCTCATCCTGCCGACATCTATTCACGCACGGTTCAGGCCTTGCTTCACCCATTCTCG
TTTCCTCGCGGCTTGGCCAGGCCCAAGTGCCGCCTTCGCGCCAGGTCTTTGATCGCGGACAAGCCTGTGATCTCT
CCCCATGCCTCTTACCTGTCCGCGCCCAGCGTCGCCTTCAACGCAGACGATCGTCGCGACGCCCAATGCCGCGTC
TTCGGCCCCGACGCCGAGGCCAGCCCGGGAGCCGCCGCCGAGCTCTCCCCCCGACCATGTGCTTATACGGTACCG
GCAGAGCCCCGTTTCCGCAACGACTGCTTCGAGGTCGCCCTGACCAGCGCCGAGGGCTGGGGCGCTTTTGCGACC
AGGAAACTGCGCCGCGGCGATGTCATCTTGTGCGAAAAGCCGCTCTTCATCGCTGACAAGCGGAGCCTATTCCAG
GAATTCGACAGACTCGGCCCGCAGGCTAGGCGCCTGGCCCTGGGTCTTCACGCCAATGAGTTGGCCAAGCCGGGA
ACGCCCCCGATCCAAAACATCTGGGAAACCAACTGTTTCACAGTGGGAGGACAGCAAGCCGGGCTTTTCCTGATC
GCATCCCGCTTCAACCATGCCTGTTACCCGGCCAACAACGTCAAGTTCCACTTCGACGCCGAAAGAGCCAGCATC
GTCCTCCGTGTTCGAGCTGACGAGATTCCAGTGGGTCAAGAGTTGCGAATATCGTATGGAAGGGGCCGCCACGCT
CTCGACCTGTACACGACGTACGGCTTTCGATGCCGATGTTATGTGTGCACGGGCTCAGACGAAAGCGACATCGTG
TCCCAGCAGTGGTGA
Gene >Hirsu2|7249
ATGGCGGTTCATCTTCAGCCTCATCCTGCCGACATCTATTCACGCACGGTTCAGGCCTTGCTTCACCCATTCTCG
TTTCCTCGCGGCTTGGCCAGGCCCAAGTGCCGCCTTCGCGCCAGGTCTTTGATCGCGGACAAGCCTGTGATCTCT
CCCCATGCCTCTTACCTGTCCGCGCCCAGCGTCGCCTTCAACGCAGACGATCGTCGCGACGCCCAATGCCGCGTC
TTCGGCCCCGACGCCGAGGCCAGCCCGGGAGCCGCCGCCGAGCTCTCCCCCCGACCATGTGCTTATACGGTACCG
GCAGAGCCCCGTTTCCGCAACGACTGCTTCGAGGTCGCCCTGACCAGCGCCGAGGGCTGGGGCGCTTTTGCGACC
AGGAAACTGCGCCGCGGCGATGTCATCTTGTGCGAAAAGCCGCTCTTCATCGCTGACAAGCGGAGCCTATTCCAG
GAATTCGACAGACTCGGCCCGCAGGCTAGGCGCCTGGCCCTGGGTCTTCACGCCAATGAGTTGGCCAAGCCGGGA
ACGCCCCCGATCCAAAACATCTGGGAAACCAACTGGTCAGTCGAGTGCTCTTCACTGATCCCGCGGTTCCTCTGT
AGCCGCTGTCCGTGCAGATTTCCGAAACGTCCCCCTTTGCCCGTTGGTGGAGGGCCGTCCGCTGACAGCCGTCTA
CAGTTTCACAGTGGGAGGACAGCAAGCCGGGCTTTTCCTGATCGCATCCCGCTTCAACCATGCCTGTTACCCGGC
CAACAACGTCAAGTTCCACTTCGACGCCGAAAGAGCCAGCATCGTCCTCCGTGTTCGAGCTGACGAGATTCCAGT
GGGTCAAGAGTTGCGAATATCGTATGGAAGGGGCCGCCACGCTCTCGACCTGTACACGACGTACGGCTTTCGATG
CCGATGTTATGTGTGCACGGGCTCAGACGAAAGCGACATCGTGTCCCAGCAGTGGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail