Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|7245
Gene name
LocationContig_41:37075..37991
Strand-
Gene length (bp)916
Transcript length (bp)819
Coding sequence length (bp)819
Protein length (aa) 273

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13578 Methyltransf_24 Methyltransferase domain 2.2E-07 111 207

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q9AJU2|ELMM1_STROV 8-demethyl-8-alpha-L-rhamnosyl tetracenomycin-C 2'-O-methyltransferase OS=Streptomyces olivaceus GN=elmMI PE=1 SV=1 61 272 9.0E-27
sp|Q9AJU1|ELMM2_STROV 8-demethyl-8-(2-methoxy-alpha-L-rhamnosyl)-tetracenomycin-C 3'-O-methyltransferase OS=Streptomyces olivaceus GN=elmMII PE=1 SV=1 49 249 7.0E-23
sp|O87833|OLEY_STRAT L-olivosyl-oleandolide 3-O-methyltransferase OS=Streptomyces antibioticus GN=oleY PE=1 SV=1 58 241 3.0E-22
sp|Q9ZHQ4|TYLE_STRFR Demethylmacrocin O-methyltransferase OS=Streptomyces fradiae GN=tylE PE=1 SV=1 41 241 3.0E-21
sp|Q83WF2|MYCE_MICGR Mycinamicin VI 2''-O-methyltransferase OS=Micromonospora griseorubida GN=mycE PE=1 SV=1 73 239 1.0E-19

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 19 0.5

Transmembrane Domains

Domain # Start End Length
1 17 39 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|7245
MASPSHPTKPARMKQNCFLFYLSCLAAGLFVVALFRHLGQDTAFLLQSKPVTYLNGSFEQVALKYGTDKVTTHNY
QLMYEKYMSPFRNLPIKMLEIGLGCNMVLITDYGPGASYHTWLEYLSHVNLYFIEYDARCANKYRDKAVNAQVYV
GDQADVAFLEQVVADTTTEGLFDIIIDDGGHTMEQQTTSLEHLWPVVKPGGLYVIEDLQTSYWPDYGGDPSTRNP
AKHTTMKYLYELLDDMMIKRDSKPVSHDLLSVECMAEICALRKRYES*
Coding >Hirsu2|7245
ATGGCCAGTCCGTCTCATCCCACCAAGCCCGCCAGGATGAAGCAGAACTGTTTCCTGTTCTATCTCTCGTGTCTA
GCGGCCGGTCTATTTGTTGTTGCCCTCTTCCGTCACCTGGGCCAAGACACGGCGTTTCTGCTGCAAAGCAAGCCG
GTCACCTATCTCAACGGATCATTCGAGCAGGTCGCTCTCAAGTATGGCACCGACAAGGTTACCACCCATAACTAC
CAATTGATGTACGAAAAGTACATGTCGCCCTTTCGAAACCTTCCAATCAAGATGCTTGAGATCGGGCTCGGTTGC
AACATGGTATTGATCACTGACTACGGACCCGGAGCATCATACCATACCTGGCTCGAATACTTGTCCCATGTTAAC
TTGTACTTCATCGAATATGATGCGCGCTGTGCCAACAAGTATCGAGACAAAGCCGTCAACGCCCAAGTCTACGTC
GGTGATCAGGCGGACGTGGCCTTTCTCGAGCAAGTTGTAGCCGACACGACGACAGAAGGCCTATTTGACATCATA
ATTGACGATGGCGGACACACCATGGAGCAGCAGACCACGTCTCTGGAGCACCTATGGCCGGTAGTCAAGCCAGGA
GGGTTATACGTGATCGAGGATCTTCAAACGAGCTACTGGCCGGACTATGGTGGTGACCCGTCGACGAGAAATCCA
GCAAAACACACAACGATGAAGTACCTGTACGAGTTATTGGACGATATGATGATCAAGCGGGATTCGAAGCCGGTC
AGCCACGACTTGCTCTCAGTGGAGTGCATGGCGGAAATTTGCGCGTTGCGAAAGAGATATGAGAGTTGA
Transcript >Hirsu2|7245
ATGGCCAGTCCGTCTCATCCCACCAAGCCCGCCAGGATGAAGCAGAACTGTTTCCTGTTCTATCTCTCGTGTCTA
GCGGCCGGTCTATTTGTTGTTGCCCTCTTCCGTCACCTGGGCCAAGACACGGCGTTTCTGCTGCAAAGCAAGCCG
GTCACCTATCTCAACGGATCATTCGAGCAGGTCGCTCTCAAGTATGGCACCGACAAGGTTACCACCCATAACTAC
CAATTGATGTACGAAAAGTACATGTCGCCCTTTCGAAACCTTCCAATCAAGATGCTTGAGATCGGGCTCGGTTGC
AACATGGTATTGATCACTGACTACGGACCCGGAGCATCATACCATACCTGGCTCGAATACTTGTCCCATGTTAAC
TTGTACTTCATCGAATATGATGCGCGCTGTGCCAACAAGTATCGAGACAAAGCCGTCAACGCCCAAGTCTACGTC
GGTGATCAGGCGGACGTGGCCTTTCTCGAGCAAGTTGTAGCCGACACGACGACAGAAGGCCTATTTGACATCATA
ATTGACGATGGCGGACACACCATGGAGCAGCAGACCACGTCTCTGGAGCACCTATGGCCGGTAGTCAAGCCAGGA
GGGTTATACGTGATCGAGGATCTTCAAACGAGCTACTGGCCGGACTATGGTGGTGACCCGTCGACGAGAAATCCA
GCAAAACACACAACGATGAAGTACCTGTACGAGTTATTGGACGATATGATGATCAAGCGGGATTCGAAGCCGGTC
AGCCACGACTTGCTCTCAGTGGAGTGCATGGCGGAAATTTGCGCGTTGCGAAAGAGATATGAGAGTTGA
Gene >Hirsu2|7245
ATGGCCAGTCCGTCTCATCCCACCAAGCCCGCCAGGATGAAGCAGAACTGTTTCCTGTTCTATCTCTCGTGTCTA
GCGGCCGGTCTATTTGTTGTTGCCCTCTTCCGTCACCTGGGCCAAGACACGGCGTTTCTGCTGCAAAGCAAGCCG
GTCACCTATCTGTGAGCAAACAGAGCCGACGCATCCCATCGGCACTGACTGCCGCGCAGCAACGGATCATTCGAG
CAGGTCGCTCTCAAGTATGGCACCGACAAGGTTACCACCCATAACTACCAATTGATGTACGAAAAGTACATGTCG
CCCTTTCGAAACCTTCCAATCAAGATGCTTGAGATCGGGCTCGGTTGCAACATGGTATTGATCACTGTCAGTTGG
TCTGTTGGATGGGAACCCTGCTTACGAACTACGACCATAGGACTACGGACCCGGAGCATCATACCATACCTGGCT
CGAATACTTGTCCCATGTTAACTTGTACTTCATCGAATATGATGCGCGCTGTGCCAACAAGTATCGAGACAAAGC
CGTCAACGCCCAAGTCTACGTCGGTGATCAGGCGGACGTGGCCTTTCTCGAGCAAGTTGTAGCCGACACGACGAC
AGAAGGCCTATTTGACATCATAATTGACGATGGCGGACACACCATGGAGCAGCAGACCACGTCTCTGGAGCACCT
ATGGCCGGTAGTCAAGCCAGGAGGGTTATACGTGATCGAGGATCTTCAAACGAGCTACTGGCCGGACTATGGTGG
TGACCCGTCGACGAGAAATCCAGCAAAACACACAACGATGAAGTACCTGTACGAGTTATTGGACGATATGATGAT
CAAGCGGGATTCGAAGCCGGTCAGCCACGACTTGCTCTCAGTGGAGTGCATGGCGGAAATTTGCGCGTTGCGAAA
GAGATATGAGAGTTGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail