Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|7244
Gene name
LocationContig_41:35903..36715
Strand+
Gene length (bp)812
Transcript length (bp)615
Coding sequence length (bp)615
Protein length (aa) 205

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03358 FMN_red NADPH-dependent FMN reductase 1.2E-08 15 145
PF02525 Flavodoxin_2 Flavodoxin-like fold 1.0E-04 4 121

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P42058|ALTA7_ALTAL Minor allergen Alt a 7 OS=Alternaria alternata GN=ALTA7 PE=1 SV=1 1 202 1.0E-95
sp|P42059|CLAH7_DAVTA Minor allergen Cla h 7 OS=Davidiella tassiana GN=CLAH7 PE=1 SV=1 1 203 3.0E-84
sp|P25349|YCP4_YEAST Flavoprotein-like protein YCP4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YCP4 PE=1 SV=1 4 201 6.0E-84
sp|Q12335|PST2_YEAST Protoplast secreted protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PST2 PE=1 SV=1 3 201 8.0E-84
sp|P30821|P25_SCHPO P25 protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=obr1 PE=1 SV=1 2 201 1.0E-73
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P42058|ALTA7_ALTAL Minor allergen Alt a 7 OS=Alternaria alternata GN=ALTA7 PE=1 SV=1 1 202 1.0E-95
sp|P42059|CLAH7_DAVTA Minor allergen Cla h 7 OS=Davidiella tassiana GN=CLAH7 PE=1 SV=1 1 203 3.0E-84
sp|P25349|YCP4_YEAST Flavoprotein-like protein YCP4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YCP4 PE=1 SV=1 4 201 6.0E-84
sp|Q12335|PST2_YEAST Protoplast secreted protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PST2 PE=1 SV=1 3 201 8.0E-84
sp|P30821|P25_SCHPO P25 protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=obr1 PE=1 SV=1 2 201 1.0E-73
sp|Q9LSQ5|FQR1_ARATH NAD(P)H dehydrogenase (quinone) FQR1 OS=Arabidopsis thaliana GN=FQR1 PE=1 SV=1 1 204 5.0E-60
sp|P38234|RFS1_YEAST Protein RFS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RFS1 PE=1 SV=1 3 199 2.0E-59
sp|Q6NQE2|FQRL1_ARATH Probable NAD(P)H dehydrogenase (quinone) FQR1-like 1 OS=Arabidopsis thaliana GN=At4g27270 PE=2 SV=1 1 204 2.0E-57
sp|Q0A961|NQOR_ALKEH NAD(P)H dehydrogenase (quinone) OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=Mlg_1277 PE=3 SV=1 4 204 5.0E-57
sp|B5BBG6|NQOR_SALPK NAD(P)H dehydrogenase (quinone) OS=Salmonella paratyphi A (strain AKU_12601) GN=SSPA1609 PE=3 SV=1 4 193 2.0E-56
sp|Q5PG91|NQOR_SALPA NAD(P)H dehydrogenase (quinone) OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=SPA1731 PE=3 SV=3 4 193 2.0E-56
sp|A8GCS6|NQOR_SERP5 NAD(P)H dehydrogenase (quinone) OS=Serratia proteamaculans (strain 568) GN=Spro_1813 PE=3 SV=1 4 201 2.0E-56
sp|Q1QYF4|NQOR_CHRSD NAD(P)H dehydrogenase (quinone) OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=Csal_1148 PE=3 SV=1 4 204 5.0E-56
sp|B1JNA9|NQOR_YERPY NAD(P)H dehydrogenase (quinone) OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=YPK_2363 PE=3 SV=1 4 204 1.0E-55
sp|Q66BP3|NQOR_YERPS NAD(P)H dehydrogenase (quinone) OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=YPTB1728 PE=3 SV=1 4 204 1.0E-55
sp|A4TK49|NQOR_YERPP NAD(P)H dehydrogenase (quinone) OS=Yersinia pestis (strain Pestoides F) GN=YPDSF_1268 PE=3 SV=1 4 204 1.0E-55
sp|Q1CHD6|NQOR_YERPN NAD(P)H dehydrogenase (quinone) OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=YPN_2266 PE=3 SV=1 4 204 1.0E-55
sp|A9R7R8|NQOR_YERPG NAD(P)H dehydrogenase (quinone) OS=Yersinia pestis bv. Antiqua (strain Angola) GN=YpAngola_A2043 PE=3 SV=1 4 204 1.0E-55
sp|Q8ZF61|NQOR_YERPE NAD(P)H dehydrogenase (quinone) OS=Yersinia pestis GN=YPO1857 PE=3 SV=1 4 204 1.0E-55
sp|B2K198|NQOR_YERPB NAD(P)H dehydrogenase (quinone) OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=YPTS_1860 PE=3 SV=1 4 204 1.0E-55
sp|Q1C8L9|NQOR_YERPA NAD(P)H dehydrogenase (quinone) OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=YPA_1236 PE=3 SV=1 4 204 1.0E-55
sp|A7FJ02|NQOR_YERP3 NAD(P)H dehydrogenase (quinone) OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=YpsIP31758_2261 PE=3 SV=1 4 204 1.0E-55
sp|Q8Z7N9|NQOR_SALTI NAD(P)H dehydrogenase (quinone) OS=Salmonella typhi GN=STY1155 PE=3 SV=3 4 193 1.0E-55
sp|Q8ZQ40|NQOR_SALTY NAD(P)H dehydrogenase (quinone) OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=STM1119 PE=3 SV=3 4 193 2.0E-55
sp|C0Q886|NQOR_SALPC NAD(P)H dehydrogenase (quinone) OS=Salmonella paratyphi C (strain RKS4594) GN=SPC_2630 PE=3 SV=1 4 193 2.0E-55
sp|A1JMU2|NQOR_YERE8 NAD(P)H dehydrogenase (quinone) OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=YE1941 PE=3 SV=1 4 201 3.0E-55
sp|B4TSN0|NQOR_SALSV NAD(P)H dehydrogenase (quinone) OS=Salmonella schwarzengrund (strain CVM19633) GN=SeSA_A1183 PE=3 SV=1 4 193 3.0E-55
sp|B4T2V2|NQOR_SALNS NAD(P)H dehydrogenase (quinone) OS=Salmonella newport (strain SL254) GN=SNSL254_A1214 PE=3 SV=1 4 193 3.0E-55
sp|B4TEP2|NQOR_SALHS NAD(P)H dehydrogenase (quinone) OS=Salmonella heidelberg (strain SL476) GN=SeHA_C1229 PE=3 SV=1 4 193 3.0E-55
sp|B5R6H0|NQOR_SALG2 NAD(P)H dehydrogenase (quinone) OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=SG1008 PE=3 SV=1 4 193 3.0E-55
sp|B5R056|NQOR_SALEP NAD(P)H dehydrogenase (quinone) OS=Salmonella enteritidis PT4 (strain P125109) GN=SEN0983 PE=3 SV=1 4 193 3.0E-55
sp|B5FR47|NQOR_SALDC NAD(P)H dehydrogenase (quinone) OS=Salmonella dublin (strain CT_02021853) GN=SeD_A1194 PE=3 SV=1 4 193 3.0E-55
sp|A9MH45|NQOR_SALAR NAD(P)H dehydrogenase (quinone) OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=SARI_01881 PE=3 SV=1 4 193 3.0E-55
sp|B5F202|NQOR_SALA4 NAD(P)H dehydrogenase (quinone) OS=Salmonella agona (strain SL483) GN=SeAg_B1078 PE=3 SV=1 4 193 3.0E-55
sp|Q32HQ6|NQOR_SHIDS NAD(P)H dehydrogenase (quinone) OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=SDY_0980 PE=3 SV=1 4 193 3.0E-55
sp|P0A8G8|NQOR_SHIFL NAD(P)H dehydrogenase (quinone) OS=Shigella flexneri GN=SF1008 PE=3 SV=2 4 193 3.0E-55
sp|Q0T630|NQOR_SHIF8 NAD(P)H dehydrogenase (quinone) OS=Shigella flexneri serotype 5b (strain 8401) GN=SFV_1016 PE=3 SV=1 4 193 3.0E-55
sp|Q1RDL3|NQOR_ECOUT NAD(P)H dehydrogenase (quinone) OS=Escherichia coli (strain UTI89 / UPEC) GN=UTI89_C1067 PE=3 SV=1 4 193 3.0E-55
sp|B1LJ00|NQOR_ECOSM NAD(P)H dehydrogenase (quinone) OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=EcSMS35_2120 PE=3 SV=1 4 193 3.0E-55
sp|B6I980|NQOR_ECOSE NAD(P)H dehydrogenase (quinone) OS=Escherichia coli (strain SE11) GN=ECSE_1066 PE=3 SV=1 4 193 3.0E-55
sp|B7N3F9|NQOR_ECOLU NAD(P)H dehydrogenase (quinone) OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=ECUMN_1186 PE=3 SV=1 4 193 3.0E-55
sp|P0A8G6|NQOR_ECOLI NAD(P)H dehydrogenase (quinone) OS=Escherichia coli (strain K12) GN=wrbA PE=1 SV=2 4 193 3.0E-55
sp|B1IV93|NQOR_ECOLC NAD(P)H dehydrogenase (quinone) OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=EcolC_2591 PE=3 SV=1 4 193 3.0E-55
sp|P0A8G7|NQOR_ECOL6 NAD(P)H dehydrogenase (quinone) OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=c1140 PE=3 SV=2 4 193 3.0E-55
sp|Q0TJ63|NQOR_ECOL5 NAD(P)H dehydrogenase (quinone) OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=ECP_1003 PE=3 SV=1 4 193 3.0E-55
sp|A1A9Q9|NQOR_ECOK1 NAD(P)H dehydrogenase (quinone) OS=Escherichia coli O1:K1 / APEC GN=Ecok1_09050 PE=1 SV=1 4 193 3.0E-55
sp|A7ZYV7|NQOR_ECOHS NAD(P)H dehydrogenase (quinone) OS=Escherichia coli O9:H4 (strain HS) GN=EcHS_A1117 PE=3 SV=1 4 193 3.0E-55
sp|B1X9C5|NQOR_ECODH NAD(P)H dehydrogenase (quinone) OS=Escherichia coli (strain K12 / DH10B) GN=ECDH10B_1076 PE=3 SV=1 4 193 3.0E-55
sp|C4ZQD2|NQOR_ECOBW NAD(P)H dehydrogenase (quinone) OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=BWG_0858 PE=3 SV=1 4 193 3.0E-55
sp|B7M8Y8|NQOR_ECO8A NAD(P)H dehydrogenase (quinone) OS=Escherichia coli O8 (strain IAI1) GN=ECIAI1_1048 PE=3 SV=1 4 193 3.0E-55
sp|B7NLC1|NQOR_ECO7I NAD(P)H dehydrogenase (quinone) OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=ECIAI39_2150 PE=3 SV=1 4 193 3.0E-55
sp|B7LFB3|NQOR_ECO55 NAD(P)H dehydrogenase (quinone) OS=Escherichia coli (strain 55989 / EAEC) GN=EC55989_1114 PE=3 SV=1 4 193 3.0E-55
sp|B7MIE9|NQOR_ECO45 NAD(P)H dehydrogenase (quinone) OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=ECS88_1018 PE=3 SV=1 4 193 3.0E-55
sp|B7UNY7|NQOR_ECO27 NAD(P)H dehydrogenase (quinone) OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=E2348C_1055 PE=3 SV=1 4 193 3.0E-55
sp|A7ZKA9|NQOR_ECO24 NAD(P)H dehydrogenase (quinone) OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=EcE24377A_1122 PE=3 SV=1 4 193 3.0E-55
sp|B7LP27|NQOR_ESCF3 NAD(P)H dehydrogenase (quinone) OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=EFER_1155 PE=3 SV=1 4 193 3.0E-55
sp|Q3Z3B7|NQOR_SHISS NAD(P)H dehydrogenase (quinone) OS=Shigella sonnei (strain Ss046) GN=SSON_1014 PE=3 SV=1 4 193 4.0E-55
sp|A9N6R4|NQOR_SALPB NAD(P)H dehydrogenase (quinone) OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=SPAB_02430 PE=3 SV=1 4 193 6.0E-55
sp|B5XXP0|NQOR_KLEP3 NAD(P)H dehydrogenase (quinone) OS=Klebsiella pneumoniae (strain 342) GN=KPK_3530 PE=3 SV=1 4 204 1.0E-54
sp|A8AI59|NQOR_CITK8 NAD(P)H dehydrogenase (quinone) OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=CKO_02047 PE=3 SV=1 4 193 7.0E-54
sp|B5YU47|NQOR_ECO5E NAD(P)H dehydrogenase (quinone) OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=ECH74115_1242 PE=3 SV=1 4 193 9.0E-54
sp|Q8X4B4|NQOR_ECO57 NAD(P)H dehydrogenase (quinone) OS=Escherichia coli O157:H7 GN=Z1423/Z1504 PE=5 SV=3 4 193 9.0E-54
sp|A4W916|NQOR_ENT38 NAD(P)H dehydrogenase (quinone) OS=Enterobacter sp. (strain 638) GN=Ent638_1516 PE=3 SV=1 4 193 6.0E-52
sp|Q9LUX9|FQRL3_ARATH Probable NAD(P)H dehydrogenase (quinone) FQR1-like 3 OS=Arabidopsis thaliana GN=At5g58800 PE=2 SV=1 4 195 1.0E-51
sp|O23207|FQRL2_ARATH Probable NAD(P)H dehydrogenase (quinone) FQR1-like 2 OS=Arabidopsis thaliana GN=At4g36750 PE=1 SV=1 4 201 2.0E-50
sp|A1U5D9|NQOR_MARHV NAD(P)H dehydrogenase (quinone) OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=Maqu_3134 PE=3 SV=1 4 193 3.0E-50
sp|Q7N5I5|NQOR_PHOLL NAD(P)H dehydrogenase (quinone) OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=plu1964 PE=3 SV=1 4 193 1.0E-49
sp|Q39LI8|NQOR_BURL3 NAD(P)H dehydrogenase (quinone) OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=Bcep18194_C7634 PE=3 SV=1 4 201 2.0E-49
sp|B3E9H6|NQOR_GEOLS NAD(P)H dehydrogenase (quinone) OS=Geobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ) GN=Glov_0105 PE=3 SV=1 4 192 4.0E-49
sp|C1I202|PNPB_PSEWB p-benzoquinone reductase OS=Pseudomonas sp. (strain WBC-3) GN=pnpB PE=1 SV=1 1 193 4.0E-49
sp|A9AT43|NQOR_BURM1 NAD(P)H dehydrogenase (quinone) OS=Burkholderia multivorans (strain ATCC 17616 / 249) GN=Bmul_6057 PE=3 SV=1 4 193 7.0E-49
sp|C4L7R5|NQOR_TOLAT NAD(P)H dehydrogenase (quinone) OS=Tolumonas auensis (strain DSM 9187 / TA4) GN=Tola_0084 PE=3 SV=1 4 204 1.0E-48
sp|A4JT91|NQOR_BURVG NAD(P)H dehydrogenase (quinone) OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) GN=Bcep1808_6600 PE=3 SV=1 4 201 1.0E-48
sp|B1KBY1|NQOR_BURCC NAD(P)H dehydrogenase (quinone) OS=Burkholderia cenocepacia (strain MC0-3) GN=Bcenmc03_6613 PE=3 SV=1 4 201 1.0E-48
sp|A0KCF0|NQOR_BURCH NAD(P)H dehydrogenase (quinone) OS=Burkholderia cenocepacia (strain HI2424) GN=Bcen2424_6131 PE=3 SV=1 4 201 2.0E-48
sp|Q1BIC1|NQOR_BURCA NAD(P)H dehydrogenase (quinone) OS=Burkholderia cenocepacia (strain AU 1054) GN=Bcen_5766 PE=3 SV=1 4 201 3.0E-48
sp|B4EPK7|NQOR_BURCJ NAD(P)H dehydrogenase (quinone) OS=Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610) GN=BceJ2315_63650 PE=3 SV=1 4 193 4.0E-48
sp|B5EMU4|NQOR_ACIF5 NAD(P)H dehydrogenase (quinone) OS=Acidithiobacillus ferrooxidans (strain ATCC 53993) GN=Lferr_0620 PE=3 SV=1 4 204 6.0E-48
sp|B7J4K3|NQOR_ACIF2 NAD(P)H dehydrogenase (quinone) OS=Acidithiobacillus ferrooxidans (strain ATCC 23270 / DSM 14882 / CIP 104768 / NCIMB 8455) GN=AFE_0460 PE=3 SV=1 4 204 6.0E-48
sp|Q0B2K2|NQOR_BURCM NAD(P)H dehydrogenase (quinone) OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=Bamb_6077 PE=3 SV=1 4 193 3.0E-46
sp|B9M9X5|NQOR_ACIET NAD(P)H dehydrogenase (quinone) OS=Acidovorax ebreus (strain TPSY) GN=Dtpsy_0057 PE=3 SV=1 4 204 5.0E-46
sp|B2T8L2|NQOR_BURPP NAD(P)H dehydrogenase (quinone) OS=Burkholderia phytofirmans (strain DSM 17436 / PsJN) GN=Bphyt_6351 PE=3 SV=1 4 193 5.0E-46
sp|B2JML0|NQOR_BURP8 NAD(P)H dehydrogenase (quinone) OS=Burkholderia phymatum (strain DSM 17167 / STM815) GN=Bphy_3669 PE=3 SV=1 4 204 6.0E-46
sp|C4XGC2|NQOR_DESMR NAD(P)H dehydrogenase (quinone) OS=Desulfovibrio magneticus (strain ATCC 700980 / DSM 13731 / RS-1) GN=DMR_02110 PE=3 SV=1 4 193 7.0E-46
sp|Q07TR7|NQOR_RHOP5 NAD(P)H dehydrogenase (quinone) OS=Rhodopseudomonas palustris (strain BisA53) GN=RPE_0710 PE=3 SV=1 4 204 8.0E-46
sp|Q5P5L5|NQOR_AROAE NAD(P)H dehydrogenase (quinone) OS=Aromatoleum aromaticum (strain EbN1) GN=AZOSEA12720 PE=3 SV=1 4 193 8.0E-46
sp|A5G020|NQOR_ACICJ NAD(P)H dehydrogenase (quinone) OS=Acidiphilium cryptum (strain JF-5) GN=Acry_2002 PE=3 SV=1 4 193 1.0E-45
sp|B1Z3G9|NQOR_BURA4 NAD(P)H dehydrogenase (quinone) OS=Burkholderia ambifaria (strain MC40-6) GN=BamMC406_5841 PE=3 SV=1 4 193 2.0E-45
sp|Q31GW8|NQOR_THICR NAD(P)H dehydrogenase (quinone) OS=Thiomicrospira crunogena (strain XCL-2) GN=Tcr_1010 PE=3 SV=1 4 192 2.0E-45
sp|A1K9S9|NQOR_AZOSB NAD(P)H dehydrogenase (quinone) OS=Azoarcus sp. (strain BH72) GN=azo2968 PE=3 SV=1 4 204 2.0E-45
sp|Q21B81|NQOR_RHOPB NAD(P)H dehydrogenase (quinone) OS=Rhodopseudomonas palustris (strain BisB18) GN=RPC_0784 PE=3 SV=1 4 204 5.0E-45
sp|Q74F05|NQOR_GEOSL NAD(P)H dehydrogenase (quinone) OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=GSU0804 PE=3 SV=1 4 204 6.0E-45
sp|P58795|NQOR_AGRFC NAD(P)H dehydrogenase (quinone) OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=Atu1728 PE=3 SV=1 4 192 1.0E-44
sp|P58796|NQOR_METAC NAD(P)H dehydrogenase (quinone) OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=MA_1189 PE=3 SV=1 4 204 1.0E-44
sp|Q39XL1|NQOR_GEOMG NAD(P)H dehydrogenase (quinone) OS=Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210) GN=Gmet_0771 PE=3 SV=1 4 204 1.0E-44
sp|B9JEB9|NQOR_AGRRK NAD(P)H dehydrogenase (quinone) OS=Agrobacterium radiobacter (strain K84 / ATCC BAA-868) GN=Arad_2057 PE=3 SV=1 4 192 2.0E-44
sp|Q9XBR5|NQOR_ZYMMO NAD(P)H dehydrogenase (quinone) OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=trpR PE=3 SV=2 3 186 5.0E-44
sp|Q3J8H5|NQOR_NITOC NAD(P)H dehydrogenase (quinone) OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=Noc_2414 PE=3 SV=1 4 193 5.0E-44
sp|Q9AA17|NQOR_CAUCR NAD(P)H dehydrogenase (quinone) OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=CC_0791 PE=3 SV=1 4 204 1.0E-43
sp|B8H1H5|NQOR_CAUCN NAD(P)H dehydrogenase (quinone) OS=Caulobacter crescentus (strain NA1000 / CB15N) GN=CCNA_00833 PE=3 SV=1 4 204 1.0E-43
sp|Q1LFW3|NQOR_CUPMC NAD(P)H dehydrogenase (quinone) OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=Rmet_4096 PE=3 SV=1 4 204 2.0E-43
sp|B0SZC3|NQOR_CAUSK NAD(P)H dehydrogenase (quinone) OS=Caulobacter sp. (strain K31) GN=Caul_4332 PE=3 SV=1 3 204 2.0E-43
sp|B0UFU2|NQOR_METS4 NAD(P)H dehydrogenase (quinone) OS=Methylobacterium sp. (strain 4-46) GN=M446_2368 PE=3 SV=1 4 193 3.0E-43
sp|Q92PU3|NQOR1_RHIME NAD(P)H dehydrogenase (quinone) 1 OS=Rhizobium meliloti (strain 1021) GN=R01635 PE=3 SV=1 4 192 5.0E-43
sp|B6ITN1|NQOR_RHOCS NAD(P)H dehydrogenase (quinone) OS=Rhodospirillum centenum (strain ATCC 51521 / SW) GN=RC1_1936 PE=3 SV=1 4 204 1.0E-42
sp|B1ZJX9|NQOR_METPB NAD(P)H dehydrogenase (quinone) OS=Methylobacterium populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001) GN=Mpop_4797 PE=3 SV=1 4 193 2.0E-42
sp|Q2IRH1|NQOR_RHOP2 NAD(P)H dehydrogenase (quinone) OS=Rhodopseudomonas palustris (strain HaA2) GN=RPB_4506 PE=3 SV=1 4 204 2.0E-42
sp|A9HFY5|NQOR_GLUDA NAD(P)H dehydrogenase (quinone) OS=Gluconacetobacter diazotrophicus (strain ATCC 49037 / DSM 5601 / PAl5) GN=GDI1484 PE=3 SV=1 4 203 2.0E-42
sp|Q130C0|NQOR_RHOPS NAD(P)H dehydrogenase (quinone) OS=Rhodopseudomonas palustris (strain BisB5) GN=RPD_4352 PE=3 SV=1 4 204 3.0E-42
sp|A8HRS7|NQOR_AZOC5 NAD(P)H dehydrogenase (quinone) OS=Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / NBRC 14845 / NCIMB 13405 / ORS 571) GN=AZC_4089 PE=3 SV=1 4 204 3.0E-42
sp|Q3SU01|NQOR_NITWN NAD(P)H dehydrogenase (quinone) OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=Nwi_0978 PE=3 SV=1 4 204 3.0E-42
sp|B3QFA1|NQOR_RHOPT NAD(P)H dehydrogenase (quinone) OS=Rhodopseudomonas palustris (strain TIE-1) GN=Rpal_0979 PE=3 SV=1 4 204 4.0E-42
sp|B9M4V3|NQOR_GEODF NAD(P)H dehydrogenase (quinone) OS=Geobacter daltonii (strain DSM 22248 / JCM 15807 / FRC-32) GN=Geob_3294 PE=3 SV=1 4 193 5.0E-42
sp|A4Z0W6|NQOR_BRASO NAD(P)H dehydrogenase (quinone) OS=Bradyrhizobium sp. (strain ORS278) GN=BRADO6142 PE=3 SV=1 4 204 6.0E-42
sp|A9VY95|NQOR_METEP NAD(P)H dehydrogenase (quinone) OS=Methylobacterium extorquens (strain PA1) GN=Mext_4280 PE=3 SV=1 4 193 6.0E-42
sp|B7KQ28|NQOR_METC4 NAD(P)H dehydrogenase (quinone) OS=Methylobacterium extorquens (strain CM4 / NCIMB 13688) GN=Mchl_4647 PE=3 SV=1 4 193 6.0E-42
sp|Q2RXG7|NQOR_RHORT NAD(P)H dehydrogenase (quinone) OS=Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1) GN=Rru_A0373 PE=3 SV=1 4 204 8.0E-42
sp|Q6NBB9|NQOR_RHOPA NAD(P)H dehydrogenase (quinone) OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=RPA0909 PE=3 SV=1 4 204 8.0E-42
sp|B1LY35|NQOR_METRJ NAD(P)H dehydrogenase (quinone) OS=Methylobacterium radiotolerans (strain ATCC 27329 / DSM 1819 / JCM 2831) GN=Mrad2831_3831 PE=3 SV=1 4 193 1.0E-41
sp|Q46B88|NQOR_METBF NAD(P)H dehydrogenase (quinone) OS=Methanosarcina barkeri (strain Fusaro / DSM 804) GN=Mbar_A1914 PE=3 SV=1 4 204 1.0E-41
sp|Q930L2|NQOR2_RHIME NAD(P)H dehydrogenase (quinone) 2 OS=Rhizobium meliloti (strain 1021) GN=RA0183 PE=3 SV=1 4 194 1.0E-41
sp|Q1MHW6|NQOR_RHIL3 NAD(P)H dehydrogenase (quinone) OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=RL1951 PE=3 SV=1 4 192 2.0E-41
sp|B6JBZ6|NQOR_OLICO NAD(P)H dehydrogenase (quinone) OS=Oligotropha carboxidovorans (strain ATCC 49405 / DSM 1227 / OM5) GN=OCAR_5077 PE=3 SV=1 4 204 5.0E-41
sp|Q89D74|NQOR_BRADU NAD(P)H dehydrogenase (quinone) OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=blr7568 PE=3 SV=1 4 204 7.0E-41
sp|A5VA47|NQOR_SPHWW NAD(P)H dehydrogenase (quinone) OS=Sphingomonas wittichii (strain RW1 / DSM 6014 / JCM 10273) GN=Swit_2810 PE=3 SV=1 3 204 8.0E-41
sp|A5ECG6|NQOR_BRASB NAD(P)H dehydrogenase (quinone) OS=Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182) GN=BBta_1650 PE=3 SV=1 4 204 9.0E-41
sp|A1WUN2|NQOR_HALHL NAD(P)H dehydrogenase (quinone) OS=Halorhodospira halophila (strain DSM 244 / SL1) GN=Hhal_0608 PE=3 SV=1 4 204 3.0E-40
sp|Q8PUV4|NQOR_METMA NAD(P)H dehydrogenase (quinone) OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=MM_2224 PE=3 SV=1 4 204 4.0E-40
sp|A1BAT3|NQOR_PARDP NAD(P)H dehydrogenase (quinone) OS=Paracoccus denitrificans (strain Pd 1222) GN=Pden_4564 PE=3 SV=1 5 193 5.0E-40
sp|B8EMJ5|NQOR_METSB NAD(P)H dehydrogenase (quinone) OS=Methylocella silvestris (strain BL2 / DSM 15510 / NCIMB 13906) GN=Msil_3216 PE=3 SV=1 4 204 6.0E-40
sp|B2IEF8|NQOR_BEII9 NAD(P)H dehydrogenase (quinone) OS=Beijerinckia indica subsp. indica (strain ATCC 9039 / DSM 1715 / NCIB 8712) GN=Bind_1932 PE=3 SV=1 3 186 2.0E-39
sp|C3MCH2|NQOR_RHISN NAD(P)H dehydrogenase (quinone) OS=Rhizobium sp. (strain NGR234) GN=NGR_c14790 PE=3 SV=1 4 192 3.0E-39
sp|A5G4G8|NQOR_GEOUR NAD(P)H dehydrogenase (quinone) OS=Geobacter uraniireducens (strain Rf4) GN=Gura_2508 PE=3 SV=1 4 193 3.0E-39
sp|C1DFX8|NQOR_AZOVD NAD(P)H dehydrogenase (quinone) OS=Azotobacter vinelandii (strain DJ / ATCC BAA-1303) GN=Avin_00380 PE=3 SV=1 4 192 7.0E-39
sp|A5VQI8|NQOR_BRUO2 NAD(P)H dehydrogenase (quinone) OS=Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512) GN=BOV_1014 PE=3 SV=1 4 204 1.0E-38
sp|A7IE31|NQOR_XANP2 NAD(P)H dehydrogenase (quinone) OS=Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2) GN=Xaut_1023 PE=3 SV=1 4 204 2.0E-38
sp|Q8G0P0|NQOR_BRUSU NAD(P)H dehydrogenase (quinone) OS=Brucella suis biovar 1 (strain 1330) GN=BR1049 PE=3 SV=1 4 204 7.0E-38
sp|A9M560|NQOR_BRUC2 NAD(P)H dehydrogenase (quinone) OS=Brucella canis (strain ATCC 23365 / NCTC 10854) GN=BCAN_A1063 PE=3 SV=1 4 204 7.0E-38
sp|Q92Y27|NQOR3_RHIME NAD(P)H dehydrogenase (quinone) 3 OS=Rhizobium meliloti (strain 1021) GN=RA1061 PE=3 SV=1 4 193 8.0E-38
sp|Q2LPM7|NQOR_SYNAS NAD(P)H dehydrogenase (quinone) OS=Syntrophus aciditrophicus (strain SB) GN=SYNAS_03520 PE=3 SV=1 4 193 1.0E-37
sp|B0CGJ9|NQOR_BRUSI NAD(P)H dehydrogenase (quinone) OS=Brucella suis (strain ATCC 23445 / NCTC 10510) GN=BSUIS_A1092 PE=3 SV=1 4 204 1.0E-37
sp|Q57D82|NQOR_BRUAB NAD(P)H dehydrogenase (quinone) OS=Brucella abortus biovar 1 (strain 9-941) GN=BruAb1_1054 PE=3 SV=1 4 204 1.0E-37
sp|Q2YQ23|NQOR_BRUA2 NAD(P)H dehydrogenase (quinone) OS=Brucella abortus (strain 2308) GN=BAB1_1070 PE=3 SV=1 4 204 1.0E-37
sp|B2S5Q9|NQOR_BRUA1 NAD(P)H dehydrogenase (quinone) OS=Brucella abortus (strain S19) GN=BAbS19_I09910 PE=3 SV=1 4 204 1.0E-37
sp|C0RJ23|NQOR_BRUMB NAD(P)H dehydrogenase (quinone) OS=Brucella melitensis biotype 2 (strain ATCC 23457) GN=BMEA_A1089 PE=3 SV=1 4 204 2.0E-37
sp|A0LNQ8|NQOR_SYNFM NAD(P)H dehydrogenase (quinone) OS=Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB) GN=Sfum_3387 PE=3 SV=1 4 193 4.0E-37
sp|Q8YH68|NQOR_BRUME NAD(P)H dehydrogenase (quinone) OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=BMEI0936 PE=3 SV=1 4 204 4.0E-37
sp|A7HVA3|NQOR_PARL1 NAD(P)H dehydrogenase (quinone) OS=Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966) GN=Plav_2222 PE=3 SV=1 4 192 6.0E-37
sp|A6W2V6|NQOR_MARMS NAD(P)H dehydrogenase (quinone) OS=Marinomonas sp. (strain MWYL1) GN=Mmwyl1_4139 PE=3 SV=1 4 203 3.0E-36
sp|A6X0U8|NQOR_OCHA4 NAD(P)H dehydrogenase (quinone) OS=Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / NCTC 12168) GN=Oant_2136 PE=3 SV=1 4 201 1.0E-35
sp|Q11IN8|NQOR_CHESB NAD(P)H dehydrogenase (quinone) OS=Chelativorans sp. (strain BNC1) GN=Meso_1341 PE=3 SV=1 4 201 2.0E-31
sp|Q9I509|NQOR_PSEAE NAD(P)H dehydrogenase (quinone) OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=PA0949 PE=1 SV=1 2 201 8.0E-26
sp|O29904|NQOR_ARCFU NAD(P)H dehydrogenase (quinone) OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=AF_0343 PE=1 SV=1 4 151 2.0E-20
sp|Q9RYU4|NQOR_DEIRA NAD(P)H dehydrogenase (quinone) OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=DR_A0214 PE=1 SV=1 4 197 7.0E-12
sp|P54586|YHCB_BACSU Uncharacterized protein YhcB OS=Bacillus subtilis (strain 168) GN=yhcB PE=3 SV=1 4 145 4.0E-08
[Show less]

GO

GO Term Description Terminal node
GO:0016491 oxidoreductase activity Yes
GO:0003824 catalytic activity No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 23 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|7244
MAPKIAIVYYSMYGHVRTLAEAEKKGVEKAGGRADLFQIPETLPKEALGKLGAPGQAADVTVLDNPDVLAEYDGF
LLGIPTRFGNFPAQWKTFWDKTGGLWARGGLYGKHAGLFVSTGGHGGGQESTCIAAMSTLAHHGIIYVPLGYAKT
FAQLTNLKEVHGGSPWGAGAFAAGDGSRQPSALELEIATAQGEIFYQTVSKASG*
Coding >Hirsu2|7244
ATGGCTCCCAAGATCGCCATCGTCTACTATTCCATGTACGGCCATGTCCGGACTCTTGCCGAGGCCGAGAAGAAG
GGCGTCGAGAAGGCCGGCGGCAGGGCCGACCTCTTTCAGATCCCAGAGACACTGCCAAAGGAGGCCTTAGGCAAG
CTTGGCGCGCCGGGCCAGGCCGCCGACGTCACTGTCCTCGACAATCCCGACGTCTTGGCTGAGTATGATGGCTTC
CTCCTCGGTATCCCCACCCGCTTCGGGAACTTTCCGGCTCAGTGGAAGACCTTTTGGGACAAGACAGGCGGCCTT
TGGGCCCGTGGTGGTCTATATGGCAAGCATGCCGGCCTCTTCGTCTCTACTGGCGGCCACGGCGGCGGCCAGGAG
TCGACTTGCATCGCCGCCATGTCGACTCTCGCCCATCACGGCATCATTTACGTTCCTCTCGGTTATGCCAAGACA
TTCGCCCAACTGACCAACCTGAAAGAAGTCCACGGCGGCAGCCCCTGGGGTGCGGGCGCCTTTGCCGCCGGCGAC
GGGTCTCGCCAGCCCAGCGCCCTTGAGCTCGAGATTGCGACGGCTCAGGGCGAGATCTTTTACCAGACCGTCTCC
AAAGCCTCAGGCTGA
Transcript >Hirsu2|7244
ATGGCTCCCAAGATCGCCATCGTCTACTATTCCATGTACGGCCATGTCCGGACTCTTGCCGAGGCCGAGAAGAAG
GGCGTCGAGAAGGCCGGCGGCAGGGCCGACCTCTTTCAGATCCCAGAGACACTGCCAAAGGAGGCCTTAGGCAAG
CTTGGCGCGCCGGGCCAGGCCGCCGACGTCACTGTCCTCGACAATCCCGACGTCTTGGCTGAGTATGATGGCTTC
CTCCTCGGTATCCCCACCCGCTTCGGGAACTTTCCGGCTCAGTGGAAGACCTTTTGGGACAAGACAGGCGGCCTT
TGGGCCCGTGGTGGTCTATATGGCAAGCATGCCGGCCTCTTCGTCTCTACTGGCGGCCACGGCGGCGGCCAGGAG
TCGACTTGCATCGCCGCCATGTCGACTCTCGCCCATCACGGCATCATTTACGTTCCTCTCGGTTATGCCAAGACA
TTCGCCCAACTGACCAACCTGAAAGAAGTCCACGGCGGCAGCCCCTGGGGTGCGGGCGCCTTTGCCGCCGGCGAC
GGGTCTCGCCAGCCCAGCGCCCTTGAGCTCGAGATTGCGACGGCTCAGGGCGAGATCTTTTACCAGACCGTCTCC
AAAGCCTCAGGCTGA
Gene >Hirsu2|7244
ATGGCTCCCAAGATCGCCATCGTCTACGTAACTCCCACCGCTCCCCGTATTGCCCCATCTCGCCATCTCGCCATG
CTCACGCCCTGCCTCTCTACAGTATTCCATGTACGGCCATGTCCGGACTCTTGCCGAGGCCGAGAAGAAGGGCGT
CGAGAAGGCCGGCGGCAGGGCCGACCTCTTTCAGATCCCAGAGACACTGCCAAAGGAGGCCTTAGGCAAGCTTGG
CGCGCCGGGCCAGGCCGCCGACGTCACTGTCCTCGACAATCCCGACGTCTTGGCTGAGTATGATGGCTTCCTCCT
CGGTATCCCCACCCGCTTCGGGAACTTTCCGGCTCAGTGGAAGGTACGTGTAACCGCGGATGGGACCAACGCGCC
ACGAAGCGATTGCTCTAGCGCTTGGGAGAACCTCACGAGACTCAATCATTGCTACGGGCTCCATCCTGACTTTTC
CCTTTTTCTTCCATCAACAGACCTTTTGGGACAAGACAGGCGGCCTTTGGGCCCGTGGTGGTCTATATGGCAAGC
ATGCCGGCCTCTTCGTCTCTACTGGCGGCCACGGCGGCGGCCAGGAGTCGACTTGCATCGCCGCCATGTCGACTC
TCGCCCATCACGGCATCATTTACGTTCCTCTCGGTTATGCCAAGACATTCGCCCAACTGACCAACCTGAAAGAAG
TCCACGGCGGCAGCCCCTGGGGTGCGGGCGCCTTTGCCGCCGGCGACGGGTCTCGCCAGCCCAGCGCCCTTGAGC
TCGAGATTGCGACGGCTCAGGGCGAGATCTTTTACCAGACCGTCTCCAAAGCCTCAGGCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail