Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|7236
Gene name
LocationContig_41:11269..14062
Strand-
Gene length (bp)2793
Transcript length (bp)2673
Coding sequence length (bp)2673
Protein length (aa) 891

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00063 Myosin_head Myosin head (motor domain) 3.0E-239 46 704
PF06017 Myosin_TH1 Unconventional myosin tail, actin- and lipid-binding 1.6E-33 762 889

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|A4RE77|MYO1_MAGO7 Myosin-1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=MYO1 PE=3 SV=1 1 890 0.0E+00
sp|Q2HDI2|MYO1_CHAGB Myosin-1 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=MYO1 PE=3 SV=1 1 890 0.0E+00
sp|Q7SDM3|MYO1_NEUCR Myosin-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=myo-1 PE=3 SV=1 1 890 0.0E+00
sp|A6SED8|MYO1_BOTFB Myosin-1 OS=Botryotinia fuckeliana (strain B05.10) GN=myoA PE=3 SV=2 1 890 0.0E+00
sp|A7EK16|MYO1_SCLS1 Myosin-1 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=myoA PE=3 SV=1 1 890 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|A4RE77|MYO1_MAGO7 Myosin-1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=MYO1 PE=3 SV=1 1 890 0.0E+00
sp|Q2HDI2|MYO1_CHAGB Myosin-1 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=MYO1 PE=3 SV=1 1 890 0.0E+00
sp|Q7SDM3|MYO1_NEUCR Myosin-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=myo-1 PE=3 SV=1 1 890 0.0E+00
sp|A6SED8|MYO1_BOTFB Myosin-1 OS=Botryotinia fuckeliana (strain B05.10) GN=myoA PE=3 SV=2 1 890 0.0E+00
sp|A7EK16|MYO1_SCLS1 Myosin-1 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=myoA PE=3 SV=1 1 890 0.0E+00
sp|A1C4A5|MYO1_ASPCL Myosin-1 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=myoA PE=3 SV=2 1 890 0.0E+00
sp|Q2US45|MYO1_ASPOR Myosin-1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=myoA PE=3 SV=1 1 890 0.0E+00
sp|Q4WC55|MYO1_ASPFU Myosin-1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=myoA PE=3 SV=2 1 890 0.0E+00
sp|B0Y9Q4|MYO1_ASPFC Myosin-1 OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=myoA PE=3 SV=2 1 890 0.0E+00
sp|A1DBH2|MYO1_NEOFI Myosin-1 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=myoA PE=3 SV=1 1 890 0.0E+00
sp|Q0CEX5|MYO1_ASPTN Myosin-1 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=myoA PE=3 SV=1 1 890 0.0E+00
sp|A2R5J1|MYO1_ASPNC Myosin-1 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=myoA PE=3 SV=1 1 890 0.0E+00
sp|Q00647|MYO1_EMENI Myosin-1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=myoA PE=1 SV=2 1 890 0.0E+00
sp|Q1DLP2|MYO1_COCIM Myosin-1 OS=Coccidioides immitis (strain RS) GN=MYO1 PE=3 SV=1 1 890 0.0E+00
sp|Q6C7C0|MYO1_YARLI Myosin-1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=MYO1 PE=3 SV=1 1 886 0.0E+00
sp|Q7Z8J6|MYO1_USTMA Myosin-1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=myo1 PE=3 SV=1 17 888 0.0E+00
sp|Q6CVE9|MYO1_KLULA Myosin-1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=MYO1 PE=3 SV=1 1 888 0.0E+00
sp|A8PWF6|MYO1_MALGO Myosin-1 OS=Malassezia globosa (strain ATCC MYA-4612 / CBS 7966) GN=MYO1 PE=3 SV=2 39 889 0.0E+00
sp|A8N2Y6|MYO1_COPC7 Myosin-1 OS=Coprinopsis cinerea (strain Okayama-7 / 130 / ATCC MYA-4618 / FGSC 9003) GN=MYO1 PE=3 SV=2 7 889 0.0E+00
sp|Q04439|MYO5_YEAST Myosin-5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MYO5 PE=1 SV=1 31 890 0.0E+00
sp|A6ZMG6|MYO5_YEAS7 Myosin-5 OS=Saccharomyces cerevisiae (strain YJM789) GN=MYO5 PE=3 SV=1 31 890 0.0E+00
sp|A7TDZ8|MYO1_VANPO Myosin-1 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=MYO1 PE=3 SV=1 3 888 0.0E+00
sp|Q6FN18|MYO5_CANGA Myosin-5 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=MYO5 PE=3 SV=1 3 886 0.0E+00
sp|Q758Q9|MYO1_ASHGO Myosin-1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=MYO1 PE=3 SV=2 31 888 0.0E+00
sp|Q59MQ0|MYO5_CANAL Myosin-5 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MYO5 PE=1 SV=1 31 888 0.0E+00
sp|P36006|MYO3_YEAST Myosin-3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MYO3 PE=1 SV=4 28 886 0.0E+00
sp|A6ZZJ1|MYO3_YEAS7 Myosin-3 OS=Saccharomyces cerevisiae (strain YJM789) GN=MYO3 PE=3 SV=1 28 886 0.0E+00
sp|B0CRJ3|MYO1_LACBS Myosin-1 OS=Laccaria bicolor (strain S238N-H82 / ATCC MYA-4686) GN=MYO1 PE=3 SV=2 7 885 0.0E+00
sp|P0CP00|MYO1_CRYNJ Myosin-1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=MYO1 PE=3 SV=1 11 890 0.0E+00
sp|P0CP01|MYO1_CRYNB Myosin-1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=MYO1 PE=3 SV=1 11 890 0.0E+00
sp|A3LYL7|MYO1_PICST Myosin-1 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=MYO1 PE=3 SV=2 6 888 0.0E+00
sp|A5E4A8|MYO1_LODEL Myosin-1 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=MYO1 PE=3 SV=1 31 886 0.0E+00
sp|Q6BUQ2|MYO1_DEBHA Myosin-1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=MYO1 PE=3 SV=2 3 888 0.0E+00
sp|Q9Y7Z8|MYO1_SCHPO Myosin-1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=myo1 PE=1 SV=1 17 886 0.0E+00
sp|A5DKH0|MYO1_PICGU Myosin-1 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=MYO1 PE=3 SV=3 1 888 0.0E+00
sp|Q6FMJ3|MYO3_CANGA Myosin-3 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=MYO3 PE=3 SV=1 27 888 0.0E+00
sp|P42522|MYOC_DICDI Myosin IC heavy chain OS=Dictyostelium discoideum GN=myoC PE=3 SV=2 41 886 0.0E+00
sp|O00160|MYO1F_HUMAN Unconventional myosin-If OS=Homo sapiens GN=MYO1F PE=1 SV=3 41 886 0.0E+00
sp|P19706|MYSB_ACACA Myosin heavy chain IB OS=Acanthamoeba castellanii GN=MIB PE=1 SV=2 44 883 0.0E+00
sp|Q12965|MYO1E_HUMAN Unconventional myosin-Ie OS=Homo sapiens GN=MYO1E PE=1 SV=2 41 886 0.0E+00
sp|P70248|MYO1F_MOUSE Unconventional myosin-If OS=Mus musculus GN=Myo1f PE=1 SV=1 41 886 0.0E+00
sp|Q63356|MYO1E_RAT Unconventional myosin-Ie OS=Rattus norvegicus GN=Myo1e PE=1 SV=1 41 886 0.0E+00
sp|E9Q634|MYO1E_MOUSE Unconventional myosin-Ie OS=Mus musculus GN=Myo1e PE=1 SV=1 41 886 0.0E+00
sp|P34092|MYOB_DICDI Myosin IB heavy chain OS=Dictyostelium discoideum GN=myoB PE=1 SV=2 44 882 0.0E+00
sp|P10569|MYSC_ACACA Myosin IC heavy chain OS=Acanthamoeba castellanii GN=MIC PE=1 SV=1 44 888 0.0E+00
sp|P34109|MYOD_DICDI Myosin ID heavy chain OS=Dictyostelium discoideum GN=myoD PE=1 SV=2 40 850 0.0E+00
sp|P22467|MYOA_DICDI Myosin IA heavy chain OS=Dictyostelium discoideum GN=myoA PE=3 SV=2 33 888 0.0E+00
sp|Q03479|MYOE_DICDI Myosin IE heavy chain OS=Dictyostelium discoideum GN=myoE PE=1 SV=2 37 770 0.0E+00
sp|Q23979|MY61F_DROME Myosin-IB OS=Drosophila melanogaster GN=Myo61F PE=1 SV=3 44 740 0.0E+00
sp|Q92002|MYO1C_LITCT Unconventional myosin-Ic OS=Lithobates catesbeiana GN=Myo1c PE=2 SV=1 37 750 0.0E+00
sp|Q27966|MYO1C_BOVIN Unconventional myosin-Ic OS=Bos taurus GN=MYO1C PE=1 SV=3 37 750 0.0E+00
sp|Q63355|MYO1C_RAT Unconventional myosin-Ic OS=Rattus norvegicus GN=Myo1c PE=1 SV=2 37 750 0.0E+00
sp|Q5ZLA6|MYO1C_CHICK Unconventional myosin-Ic OS=Gallus gallus GN=MYO1C PE=2 SV=1 37 750 0.0E+00
sp|Q9D6A1|MYO1H_MOUSE Unconventional myosin-Ih OS=Mus musculus GN=Myo1h PE=2 SV=2 37 799 0.0E+00
sp|Q8N1T3|MYO1H_HUMAN Unconventional myosin-Ih OS=Homo sapiens GN=MYO1H PE=2 SV=2 37 799 0.0E+00
sp|O00159|MYO1C_HUMAN Unconventional myosin-Ic OS=Homo sapiens GN=MYO1C PE=1 SV=4 37 750 0.0E+00
sp|Q9WTI7|MYO1C_MOUSE Unconventional myosin-Ic OS=Mus musculus GN=Myo1c PE=1 SV=2 37 750 0.0E+00
sp|P46735|MYO1B_MOUSE Unconventional myosin-Ib OS=Mus musculus GN=Myo1b PE=1 SV=3 43 734 0.0E+00
sp|O43795|MYO1B_HUMAN Unconventional myosin-Ib OS=Homo sapiens GN=MYO1B PE=1 SV=3 43 734 0.0E+00
sp|Q05096|MYO1B_RAT Unconventional myosin-Ib OS=Rattus norvegicus GN=Myo1b PE=1 SV=1 43 734 0.0E+00
sp|Q23978|MY31D_DROME Myosin-IA OS=Drosophila melanogaster GN=Myo31DF PE=2 SV=1 40 881 0.0E+00
sp|A0MP03|MY1CA_XENLA Unconventional myosin-Ic-A OS=Xenopus laevis GN=myo1c-a PE=1 SV=1 37 750 0.0E+00
sp|O94832|MYO1D_HUMAN Unconventional myosin-Id OS=Homo sapiens GN=MYO1D PE=1 SV=2 42 768 4.0E-178
sp|Q17R14|MYO1D_BOVIN Unconventional myosin-Id OS=Bos taurus GN=MYO1D PE=2 SV=1 42 751 1.0E-177
sp|Q63357|MYO1D_RAT Unconventional myosin-Id OS=Rattus norvegicus GN=Myo1d PE=1 SV=3 42 772 1.0E-177
sp|Q5SUA5|MYO1G_MOUSE Unconventional myosin-Ig OS=Mus musculus GN=Myo1g PE=1 SV=1 42 762 3.0E-177
sp|B0I1T2|MYO1G_HUMAN Unconventional myosin-Ig OS=Homo sapiens GN=MYO1G PE=1 SV=2 42 767 8.0E-177
sp|Q5SYD0|MYO1D_MOUSE Unconventional myosin-Id OS=Mus musculus GN=Myo1d PE=1 SV=1 42 772 2.0E-175
sp|Q9UBC5|MYO1A_HUMAN Unconventional myosin-Ia OS=Homo sapiens GN=MYO1A PE=1 SV=1 43 734 1.0E-174
sp|O88329|MYO1A_MOUSE Unconventional myosin-Ia OS=Mus musculus GN=Myo1a PE=2 SV=2 43 734 3.0E-174
sp|Q5ZMC2|MYO1G_CHICK Unconventional myosin-Ig OS=Gallus gallus GN=MYO1G PE=2 SV=1 42 761 5.0E-174
sp|Q62774|MYO1A_RAT Unconventional myosin-Ia (Fragment) OS=Rattus norvegicus GN=Myo1a PE=2 SV=1 44 734 8.0E-174
sp|A5PF48|MYO1C_DANRE Unconventional myosin-Ic OS=Danio rerio GN=myo1c PE=3 SV=1 37 750 9.0E-174
sp|P10568|MYO1A_BOVIN Unconventional myosin-Ia OS=Bos taurus GN=MYO1A PE=2 SV=1 43 734 1.0E-173
sp|P47807|MYO1A_CHICK Unconventional myosin-Ia OS=Gallus gallus GN=MYO1A PE=1 SV=2 44 736 2.0E-170
sp|Q9U1M8|MYOI_DICDI Myosin-I heavy chain OS=Dictyostelium discoideum GN=myoI PE=1 SV=1 45 777 7.0E-159
sp|P54695|MYOF_DICDI Myosin IF heavy chain OS=Dictyostelium discoideum GN=myoF PE=3 SV=2 37 781 4.0E-157
sp|Q9XXV8|MYOK_DICDI Myosin-K heavy chain OS=Dictyostelium discoideum GN=myoK PE=2 SV=1 163 715 3.0E-153
sp|Q39160|MYO5_ARATH Myosin-5 OS=Arabidopsis thaliana GN=XI-1 PE=1 SV=1 44 736 2.0E-152
sp|Q9LKB9|MYO6_ARATH Myosin-6 OS=Arabidopsis thaliana GN=XI-2 PE=1 SV=1 44 750 3.0E-152
sp|F4K5J1|MYO17_ARATH Myosin-17 OS=Arabidopsis thaliana GN=XI-K PE=1 SV=2 44 768 6.0E-152
sp|Q9M2K0|MYO16_ARATH Myosin-16 OS=Arabidopsis thaliana GN=XI-J PE=2 SV=1 44 750 1.0E-151
sp|F4IVR7|MYO10_ARATH Myosin-10 OS=Arabidopsis thaliana GN=XI-D PE=3 SV=1 20 797 5.0E-151
sp|Q99MZ6|MYO7B_MOUSE Unconventional myosin-VIIb OS=Mus musculus GN=Myo7b PE=1 SV=3 44 862 4.0E-150
sp|Q622K8|HUM6_CAEBR Unconventional myosin heavy chain 6 OS=Caenorhabditis briggsae GN=hum-6 PE=3 SV=1 44 750 3.0E-149
sp|Q29P71|MYO7A_DROPS Myosin-VIIa OS=Drosophila pseudoobscura pseudoobscura GN=ck PE=3 SV=1 44 791 5.0E-149
sp|Q9V3Z6|MYO7A_DROME Myosin-VIIa OS=Drosophila melanogaster GN=ck PE=1 SV=1 44 791 2.0E-148
sp|F4IUG9|MYO13_ARATH Myosin-13 OS=Arabidopsis thaliana GN=XI-G PE=3 SV=1 18 777 5.0E-148
sp|P91443|HUM6_CAEEL Unconventional myosin heavy chain 6 OS=Caenorhabditis elegans GN=hum-6 PE=1 SV=1 44 750 9.0E-148
sp|F4IRU3|MYO12_ARATH Myosin-12 OS=Arabidopsis thaliana GN=XI-F PE=2 SV=1 44 752 1.0E-147
sp|Q17LW0|MYO7A_AEDAE Myosin-VIIa OS=Aedes aegypti GN=ck PE=3 SV=1 44 750 3.0E-147
sp|Q13402|MYO7A_HUMAN Unconventional myosin-VIIa OS=Homo sapiens GN=MYO7A PE=1 SV=2 44 750 6.0E-147
sp|P54697|MYOJ_DICDI Myosin-J heavy chain OS=Dictyostelium discoideum GN=myoJ PE=3 SV=2 44 765 9.0E-147
sp|F4JM19|MYO14_ARATH Myosin-14 OS=Arabidopsis thaliana GN=XI-H PE=3 SV=1 18 762 1.0E-146
sp|P97479|MYO7A_MOUSE Unconventional myosin-VIIa OS=Mus musculus GN=Myo7a PE=1 SV=2 44 750 7.0E-146
sp|F4HWY6|MYO11_ARATH Myosin-11 OS=Arabidopsis thaliana GN=XI-E PE=3 SV=1 44 779 8.0E-146
sp|F4HXP9|MYO9_ARATH Myosin-9 OS=Arabidopsis thaliana GN=XI-C PE=2 SV=1 44 779 3.0E-145
sp|F4I460|MYO8_ARATH Myosin-8 OS=Arabidopsis thaliana GN=XI-B PE=3 SV=1 44 750 3.0E-145
sp|P05659|MYSN_ACACA Myosin-2 heavy chain, non muscle OS=Acanthamoeba castellanii PE=3 SV=1 44 746 3.0E-145
sp|Q6PIF6|MYO7B_HUMAN Unconventional myosin-VIIb OS=Homo sapiens GN=MYO7B PE=1 SV=2 44 750 5.0E-145
sp|F4I5Q6|MYO7_ARATH Myosin-7 OS=Arabidopsis thaliana GN=XI-A PE=3 SV=1 18 750 2.0E-144
sp|P08799|MYS2_DICDI Myosin-2 heavy chain OS=Dictyostelium discoideum GN=mhcA PE=1 SV=3 44 738 4.0E-144
sp|Q0WPU1|MYO15_ARATH Myosin-15 OS=Arabidopsis thaliana GN=XI-I PE=1 SV=1 44 779 5.0E-144
sp|Q9UKN7|MYO15_HUMAN Unconventional myosin-XV OS=Homo sapiens GN=MYO15A PE=1 SV=2 42 791 1.0E-143
sp|Q9QZZ4|MYO15_MOUSE Unconventional myosin-XV OS=Mus musculus GN=Myo15a PE=1 SV=2 39 791 3.0E-143
sp|P47808|MYSH_ACACA High molecular weight form of myosin-1 OS=Acanthamoeba castellanii PE=3 SV=1 45 738 4.0E-143
sp|P79114|MYO10_BOVIN Unconventional myosin-X OS=Bos taurus GN=MYO10 PE=1 SV=1 42 776 1.0E-142
sp|P19524|MYO2_YEAST Myosin-2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MYO2 PE=1 SV=1 44 733 4.0E-142
sp|Q876G9|MYO2_SACU7 Myosin-2 OS=Saccharomyces uvarum (strain ATCC 76518 / CBS 7001 / CLIB 283 / NBRC 10550 / MCYC 623 / NCYC 2669 / NRRL Y-11845) GN=MYO2 PE=3 SV=2 44 733 2.0E-141
sp|Q875X4|MYO2B_NAUCC Myosin-2B OS=Naumovozyma castellii (strain ATCC 76901 / CBS 4309 / NBRC 1992 / NRRL Y-12630) GN=MYO2B PE=3 SV=2 47 733 7.0E-140
sp|Q9HD67|MYO10_HUMAN Unconventional myosin-X OS=Homo sapiens GN=MYO10 PE=1 SV=3 42 704 2.0E-139
sp|Q875Q8|MYO2_LACK1 Myosin-2 OS=Lachancea kluyveri (strain ATCC 58438 / CBS 3082 / CCRC 21498 / NBRC 1685 / JCM 7257 / NCYC 543 / NRRL Y-12651) GN=MYO2 PE=3 SV=1 44 733 3.0E-139
sp|F8VQB6|MYO10_MOUSE Unconventional myosin-X OS=Mus musculus GN=Myo10 PE=1 SV=1 42 776 6.0E-139
sp|D3ZJP6|MYO10_RAT Unconventional myosin-X OS=Rattus norvegicus GN=Myo10 PE=1 SV=1 42 776 7.0E-139
sp|O94477|MYO52_SCHPO Myosin-52 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=myo52 PE=1 SV=1 47 768 2.0E-138
sp|Q9LHE9|MYO1_ARATH Myosin-1 OS=Arabidopsis thaliana GN=VIII-1 PE=1 SV=1 44 762 1.0E-137
sp|Q875X3|MYO2A_NAUCC Myosin-2A OS=Naumovozyma castellii (strain ATCC 76901 / CBS 4309 / NBRC 1992 / NRRL Y-12630) GN=MYO2A PE=3 SV=2 47 733 3.0E-137
sp|Q99104|MYO5A_MOUSE Unconventional myosin-Va OS=Mus musculus GN=Myo5a PE=1 SV=2 43 760 1.0E-136
sp|Q9QYF3|MYO5A_RAT Unconventional myosin-Va OS=Rattus norvegicus GN=Myo5a PE=1 SV=1 43 760 2.0E-136
sp|P32492|MYO4_YEAST Myosin-4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MYO4 PE=1 SV=1 47 733 5.0E-136
sp|P70569|MYO5B_RAT Unconventional myosin-Vb OS=Rattus norvegicus GN=Myo5b PE=1 SV=1 43 735 3.0E-135
sp|Q9ULV0|MYO5B_HUMAN Unconventional myosin-Vb OS=Homo sapiens GN=MYO5B PE=1 SV=3 43 785 4.0E-135
sp|Q02440|MYO5A_CHICK Unconventional myosin-Va OS=Gallus gallus GN=MYO5A PE=1 SV=1 43 760 4.0E-135
sp|Q9Y4I1|MYO5A_HUMAN Unconventional myosin-Va OS=Homo sapiens GN=MYO5A PE=1 SV=2 43 760 6.0E-135
sp|P21271|MYO5B_MOUSE Unconventional myosin-Vb OS=Mus musculus GN=Myo5b PE=1 SV=2 43 778 8.0E-135
sp|F4I507|MYO3_ARATH Myosin-3 OS=Arabidopsis thaliana GN=VIII-A PE=2 SV=1 44 808 4.0E-133
sp|F4JIU4|MYO4_ARATH Myosin-4 OS=Arabidopsis thaliana GN=VIII-B PE=3 SV=1 44 734 2.0E-132
sp|F4K0A6|MYO2_ARATH Myosin-2 OS=Arabidopsis thaliana GN=VIII-2 PE=2 SV=1 44 736 2.0E-131
sp|Q9USI6|MYO2_SCHPO Myosin type-2 heavy chain 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=myo2 PE=1 SV=1 45 735 4.0E-131
sp|F1PT61|MYH16_CANLF Myosin-16 OS=Canis lupus familiaris GN=MYH16 PE=3 SV=2 45 762 8.0E-131
sp|P24733|MYS_ARGIR Myosin heavy chain, striated muscle OS=Argopecten irradians PE=1 SV=1 45 748 2.0E-129
sp|P12847|MYH3_RAT Myosin-3 OS=Rattus norvegicus GN=Myh3 PE=3 SV=1 45 747 3.0E-129
sp|P13541|MYH3_MOUSE Myosin-3 OS=Mus musculus GN=Myh3 PE=2 SV=2 45 747 5.0E-129
sp|O74805|MYO51_SCHPO Myosin-51 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=myo51 PE=3 SV=1 46 705 9.0E-129
sp|Q8MJU9|MYH7_HORSE Myosin-7 OS=Equus caballus GN=MYH7 PE=2 SV=1 45 736 2.0E-128
sp|P11055|MYH3_HUMAN Myosin-3 OS=Homo sapiens GN=MYH3 PE=1 SV=3 45 747 5.0E-128
sp|Q9NQX4|MYO5C_HUMAN Unconventional myosin-Vc OS=Homo sapiens GN=MYO5C PE=1 SV=2 43 754 1.0E-127
sp|P12883|MYH7_HUMAN Myosin-7 OS=Homo sapiens GN=MYH7 PE=1 SV=5 45 736 2.0E-127
sp|Q8MJV1|MYH2_HORSE Myosin-2 OS=Equus caballus GN=MYH2 PE=2 SV=1 45 747 2.0E-127
sp|Q076A3|MYH13_CANLF Myosin-13 OS=Canis lupus familiaris GN=MYH13 PE=3 SV=1 45 735 2.0E-127
sp|Q9UKX2|MYH2_HUMAN Myosin-2 OS=Homo sapiens GN=MYH2 PE=1 SV=1 45 747 3.0E-127
sp|Q9BE41|MYH2_BOVIN Myosin-2 OS=Bos taurus GN=MYH2 PE=2 SV=1 45 747 6.0E-127
sp|Q569U0|MYO19_XENLA Unconventional myosin-XIX OS=Xenopus laevis GN=myo19 PE=2 SV=1 35 753 7.0E-127
sp|Q27991|MYH10_BOVIN Myosin-10 OS=Bos taurus GN=MYH10 PE=2 SV=2 45 762 1.0E-126
sp|P35580|MYH10_HUMAN Myosin-10 OS=Homo sapiens GN=MYH10 PE=1 SV=3 45 762 1.0E-126
sp|Q61879|MYH10_MOUSE Myosin-10 OS=Mus musculus GN=Myh10 PE=1 SV=2 45 762 1.0E-126
sp|A2AQP0|MYH7B_MOUSE Myosin-7B OS=Mus musculus GN=Myh7b PE=3 SV=1 45 735 2.0E-126
sp|Q9BE40|MYH1_BOVIN Myosin-1 OS=Bos taurus GN=MYH1 PE=2 SV=2 45 747 2.0E-126
sp|Q8SS35|Y4A0_ENCCU Probable myosin heavy chain ECU04_1000 OS=Encephalitozoon cuniculi (strain GB-M1) GN=ECU04_1000 PE=1 SV=2 45 755 2.0E-126
sp|P49824|MYH7_CANLF Myosin-7 OS=Canis lupus familiaris GN=MYH7 PE=1 SV=3 45 736 2.0E-126
sp|P13542|MYH8_MOUSE Myosin-8 OS=Mus musculus GN=Myh8 PE=2 SV=2 45 735 2.0E-126
sp|Q91Z83|MYH7_MOUSE Myosin-7 OS=Mus musculus GN=Myh7 PE=1 SV=1 45 736 2.0E-126
sp|Q9UKX3|MYH13_HUMAN Myosin-13 OS=Homo sapiens GN=MYH13 PE=2 SV=2 45 735 3.0E-126
sp|P13538|MYSS_CHICK Myosin heavy chain, skeletal muscle, adult OS=Gallus gallus PE=1 SV=4 45 735 3.0E-126
sp|P12882|MYH1_HUMAN Myosin-1 OS=Homo sapiens GN=MYH1 PE=1 SV=3 45 747 4.0E-126
sp|P79293|MYH7_PIG Myosin-7 OS=Sus scrofa GN=MYH7 PE=2 SV=2 45 736 5.0E-126
sp|P02564|MYH7_RAT Myosin-7 OS=Rattus norvegicus GN=Myh7 PE=1 SV=2 45 736 5.0E-126
sp|Q9TV63|MYH2_PIG Myosin-2 OS=Sus scrofa GN=MYH2 PE=2 SV=1 45 747 5.0E-126
sp|Q8MJV0|MYH1_HORSE Myosin-1 OS=Equus caballus GN=MYH1 PE=2 SV=1 45 747 6.0E-126
sp|Q9TV62|MYH4_PIG Myosin-4 OS=Sus scrofa GN=MYH4 PE=2 SV=1 45 735 8.0E-126
sp|Q9BE39|MYH7_BOVIN Myosin-7 OS=Bos taurus GN=MYH7 PE=2 SV=1 45 736 9.0E-126
sp|P13535|MYH8_HUMAN Myosin-8 OS=Homo sapiens GN=MYH8 PE=1 SV=3 45 747 1.0E-125
sp|A7E2Y1|MYH7B_HUMAN Myosin-7B OS=Homo sapiens GN=MYH7B PE=1 SV=3 45 735 1.0E-125
sp|Q076A7|MYH2_CANLF Myosin-2 OS=Canis lupus familiaris GN=MYH2 PE=3 SV=1 45 747 1.0E-125
sp|P02563|MYH6_RAT Myosin-6 OS=Rattus norvegicus GN=Myh6 PE=1 SV=2 45 735 3.0E-125
sp|Q5SX40|MYH1_MOUSE Myosin-1 OS=Mus musculus GN=Myh1 PE=1 SV=1 45 747 4.0E-125
sp|Q076A4|MYH8_CANLF Myosin-8 OS=Canis lupus familiaris GN=MYH8 PE=3 SV=1 45 747 4.0E-125
sp|Q29RW1|MYH4_RAT Myosin-4 OS=Rattus norvegicus GN=Myh4 PE=1 SV=1 11 735 6.0E-125
sp|Q9TV61|MYH1_PIG Myosin-1 OS=Sus scrofa GN=MYH1 PE=2 SV=1 45 747 9.0E-125
sp|Q8VDD5|MYH9_MOUSE Myosin-9 OS=Mus musculus GN=Myh9 PE=1 SV=4 45 763 1.0E-124
sp|Q9JLT0|MYH10_RAT Myosin-10 OS=Rattus norvegicus GN=Myh10 PE=1 SV=1 45 762 2.0E-124
sp|P13533|MYH6_HUMAN Myosin-6 OS=Homo sapiens GN=MYH6 PE=1 SV=5 45 735 2.0E-124
sp|P35579|MYH9_HUMAN Myosin-9 OS=Homo sapiens GN=MYH9 PE=1 SV=4 45 763 2.0E-124
sp|Q62812|MYH9_RAT Myosin-9 OS=Rattus norvegicus GN=Myh9 PE=1 SV=3 45 763 3.0E-124
sp|P35749|MYH11_HUMAN Myosin-11 OS=Homo sapiens GN=MYH11 PE=1 SV=3 45 763 3.0E-124
sp|Q5SX39|MYH4_MOUSE Myosin-4 OS=Mus musculus GN=Myh4 PE=2 SV=1 11 735 3.0E-124
sp|P35748|MYH11_RABIT Myosin-11 OS=Oryctolagus cuniculus GN=MYH11 PE=2 SV=2 45 763 6.0E-124
sp|Q076A6|MYH1_CANLF Myosin-1 OS=Canis lupus familiaris GN=MYH1 PE=3 SV=2 45 747 7.0E-124
sp|Q076A5|MYH4_CANLF Myosin-4 OS=Canis lupus familiaris GN=MYH4 PE=3 SV=1 45 735 9.0E-124
sp|Q258K2|MYH9_CANLF Myosin-9 OS=Canis lupus familiaris GN=MYH9 PE=2 SV=1 45 763 1.0E-123
sp|P10587|MYH11_CHICK Myosin-11 OS=Gallus gallus GN=MYH11 PE=1 SV=4 45 763 2.0E-123
sp|Q02566|MYH6_MOUSE Myosin-6 OS=Mus musculus GN=Myh6 PE=1 SV=2 45 735 2.0E-123
sp|Q28641|MYH4_RABIT Myosin-4 OS=Oryctolagus cuniculus GN=MYH4 PE=2 SV=1 45 747 3.0E-123
sp|Q9Y623|MYH4_HUMAN Myosin-4 OS=Homo sapiens GN=MYH4 PE=1 SV=2 45 735 3.0E-123
sp|P14105|MYH9_CHICK Myosin-9 OS=Gallus gallus GN=MYH9 PE=2 SV=1 45 763 4.0E-123
sp|P13539|MYH6_MESAU Myosin-6 OS=Mesocricetus auratus GN=MYH6 PE=2 SV=2 45 735 5.0E-123
sp|Q90339|MYSS_CYPCA Myosin heavy chain, fast skeletal muscle OS=Cyprinus carpio PE=2 SV=2 45 735 1.0E-122
sp|P02565|MYH3_CHICK Myosin-3 OS=Gallus gallus GN=MYH3 PE=2 SV=3 45 735 5.0E-122
sp|Q99323|MYSN_DROME Myosin heavy chain, non-muscle OS=Drosophila melanogaster GN=zip PE=1 SV=2 45 763 6.0E-122
sp|P13540|MYH7_MESAU Myosin-7 OS=Mesocricetus auratus GN=MYH7 PE=2 SV=2 45 736 8.0E-122
sp|O08638|MYH11_MOUSE Myosin-11 OS=Mus musculus GN=Myh11 PE=1 SV=1 45 763 2.0E-120
sp|P54696|MYOH_DICDI Myosin-H heavy chain OS=Dictyostelium discoideum GN=myoH PE=3 SV=3 44 744 2.0E-120
sp|Q9UM54|MYO6_HUMAN Unconventional myosin-VI OS=Homo sapiens GN=MYO6 PE=1 SV=4 45 753 3.0E-119
sp|P05661|MYSA_DROME Myosin heavy chain, muscle OS=Drosophila melanogaster GN=Mhc PE=1 SV=4 45 762 4.0E-119
sp|O14157|MYO3_SCHPO Myosin type-2 heavy chain 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=myo3 PE=1 SV=1 45 751 5.0E-119
sp|P08964|MYO1_YEAST Myosin-1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MYO1 PE=1 SV=3 45 758 5.0E-119
sp|Q5SV80|MYO19_MOUSE Unconventional myosin-XIX OS=Mus musculus GN=Myo19 PE=2 SV=1 45 788 5.0E-118
sp|Q29122|MYO6_PIG Unconventional myosin-VI OS=Sus scrofa GN=MYO6 PE=1 SV=1 45 753 2.0E-117
sp|O00936|MYOB_TOXGO Myosin-B/C OS=Toxoplasma gondii PE=2 SV=4 45 735 3.0E-117
sp|Q9I8D1|MYO6_CHICK Unconventional myosin-VI OS=Gallus gallus GN=MYO6 PE=1 SV=1 45 753 3.0E-117
sp|Q96H55|MYO19_HUMAN Unconventional myosin-XIX OS=Homo sapiens GN=MYO19 PE=1 SV=2 45 665 4.0E-117
sp|P12844|MYO3_CAEEL Myosin-3 OS=Caenorhabditis elegans GN=myo-3 PE=2 SV=1 45 736 2.0E-116
sp|Q28970|MYO7A_PIG Unconventional myosin-VIIa (Fragment) OS=Sus scrofa GN=MYO7A PE=2 SV=1 51 538 6.0E-116
sp|Q7Z406|MYH14_HUMAN Myosin-14 OS=Homo sapiens GN=MYH14 PE=1 SV=2 45 762 1.0E-115
sp|Q9Y2K3|MYH15_HUMAN Myosin-15 OS=Homo sapiens GN=MYH15 PE=1 SV=5 45 748 3.0E-115
sp|Q60LV4|MYO3_CAEBR Myosin-3 OS=Caenorhabditis briggsae GN=myo-3 PE=3 SV=1 45 736 8.0E-115
sp|Q7RQ71|MYOA_PLAYO Myosin-A OS=Plasmodium yoelii yoelii GN=PY01232 PE=1 SV=1 47 752 1.0E-113
sp|Q8NEV4|MYO3A_HUMAN Myosin-IIIa OS=Homo sapiens GN=MYO3A PE=2 SV=2 45 774 5.0E-113
sp|Q9UAR6|MYOA_PLAFB Myosin-A OS=Plasmodium falciparum (isolate FCBR / Columbia) PE=2 SV=1 47 752 1.0E-112
sp|Q8IDR3|MYOA_PLAF7 Myosin-A OS=Plasmodium falciparum (isolate 3D7) GN=PF13_0233 PE=1 SV=1 47 752 1.0E-112
sp|Q01989|MYS9_DROME Myosin heavy chain 95F OS=Drosophila melanogaster GN=jar PE=2 SV=4 61 704 7.0E-112
sp|P02567|MYO1_CAEEL Myosin-1 OS=Caenorhabditis elegans GN=myo-1 PE=1 SV=3 45 746 1.0E-111
sp|Q8WXR4|MYO3B_HUMAN Myosin-IIIb OS=Homo sapiens GN=MYO3B PE=2 SV=4 47 704 2.0E-110
sp|Q6URW6|MYH14_MOUSE Myosin-14 OS=Mus musculus GN=Myh14 PE=1 SV=1 45 735 4.0E-110
sp|P12845|MYO2_CAEEL Myosin-2 OS=Caenorhabditis elegans GN=myo-2 PE=1 SV=2 45 758 7.0E-110
sp|P02566|MYO4_CAEEL Myosin-4 OS=Caenorhabditis elegans GN=unc-54 PE=1 SV=2 36 738 4.0E-109
sp|Q63862|MYH11_RAT Myosin-11 (Fragments) OS=Rattus norvegicus GN=Myh11 PE=1 SV=3 103 763 7.0E-109
sp|Q1EG27|MYO3B_MOUSE Myosin-IIIb OS=Mus musculus GN=Myo3b PE=2 SV=2 47 704 6.0E-108
sp|Q9Z1N3|MYO9A_RAT Unconventional myosin-IXa OS=Rattus norvegicus GN=Myo9a PE=1 SV=1 23 563 8.0E-107
sp|Q8C170|MYO9A_MOUSE Unconventional myosin-IXa OS=Mus musculus GN=Myo9a PE=1 SV=2 23 563 1.0E-106
sp|B2RTY4|MYO9A_HUMAN Unconventional myosin-IXa OS=Homo sapiens GN=MYO9A PE=1 SV=2 23 563 1.0E-106
sp|O00934|MYOA_TOXGO Myosin-A OS=Toxoplasma gondii PE=1 SV=1 47 704 2.0E-104
sp|Q13459|MYO9B_HUMAN Unconventional myosin-IXb OS=Homo sapiens GN=MYO9B PE=1 SV=3 40 567 9.0E-104
sp|Q63358|MYO9B_RAT Unconventional myosin-IXb OS=Rattus norvegicus GN=Myo9b PE=1 SV=1 15 567 2.0E-103
sp|Q9QY06|MYO9B_MOUSE Unconventional myosin-IXb OS=Mus musculus GN=Myo9b PE=1 SV=2 15 567 5.0E-103
sp|Q8K3H5|MYO3A_MOUSE Myosin-IIIa OS=Mus musculus GN=Myo3a PE=2 SV=1 45 774 6.0E-103
sp|Q9XYF6|MYOD_TOXGO Myosin-D OS=Toxoplasma gondii PE=2 SV=1 47 756 9.0E-101
sp|Q64331|MYO6_MOUSE Unconventional myosin-VI OS=Mus musculus GN=Myo6 PE=1 SV=1 45 753 3.0E-100
sp|Q9TW28|MYOM_DICDI Myosin-M heavy chain OS=Dictyostelium discoideum GN=myoM PE=1 SV=1 46 567 4.0E-84
sp|Q86AC8|MYOG_DICDI Myosin-G heavy chain OS=Dictyostelium discoideum GN=myoG PE=3 SV=1 37 549 1.0E-76
sp|Q9Y6X6|MYO16_HUMAN Unconventional myosin-XVI OS=Homo sapiens GN=MYO16 PE=2 SV=3 47 573 5.0E-68
sp|Q9ERC1|MYO16_RAT Unconventional myosin-XVI OS=Rattus norvegicus GN=Myo16 PE=1 SV=1 47 567 2.0E-66
sp|Q5DU14|MYO16_MOUSE Unconventional myosin-XVI OS=Mus musculus GN=Myo16 PE=1 SV=2 47 573 4.0E-65
sp|P10676|NINAC_DROME Neither inactivation nor afterpotential protein C OS=Drosophila melanogaster GN=ninaC PE=1 SV=2 39 751 1.0E-63
sp|Q4P9K9|CHS8_USTMA Chitin synthase 8 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=CHS8 PE=3 SV=1 45 559 3.0E-62
sp|P04461|MYH7_RABIT Myosin-7 (Fragment) OS=Oryctolagus cuniculus GN=MYH7 PE=2 SV=1 388 747 4.0E-50
sp|Q92614|MY18A_HUMAN Unconventional myosin-XVIIIa OS=Homo sapiens GN=MYO18A PE=1 SV=3 45 458 2.0E-46
sp|Q9JMH9|MY18A_MOUSE Unconventional myosin-XVIIIa OS=Mus musculus GN=Myo18a PE=1 SV=2 45 472 2.0E-43
sp|Q8IUG5|MY18B_HUMAN Unconventional myosin-XVIIIb OS=Homo sapiens GN=MYO18B PE=1 SV=1 45 464 4.0E-31
sp|Q9XXV8|MYOK_DICDI Myosin-K heavy chain OS=Dictyostelium discoideum GN=myoK PE=2 SV=1 44 157 6.0E-22
sp|Q8C170|MYO9A_MOUSE Unconventional myosin-IXa OS=Mus musculus GN=Myo9a PE=1 SV=2 576 750 5.0E-16
sp|Q13459|MYO9B_HUMAN Unconventional myosin-IXb OS=Homo sapiens GN=MYO9B PE=1 SV=3 553 750 8.0E-16
sp|Q9Z1N3|MYO9A_RAT Unconventional myosin-IXa OS=Rattus norvegicus GN=Myo9a PE=1 SV=1 576 750 1.0E-15
sp|B2RTY4|MYO9A_HUMAN Unconventional myosin-IXa OS=Homo sapiens GN=MYO9A PE=1 SV=2 576 750 1.0E-15
sp|Q9QY06|MYO9B_MOUSE Unconventional myosin-IXb OS=Mus musculus GN=Myo9b PE=1 SV=2 576 750 1.0E-15
sp|Q63358|MYO9B_RAT Unconventional myosin-IXb OS=Rattus norvegicus GN=Myo9b PE=1 SV=1 576 750 2.0E-15
sp|Q96JP2|MY15B_HUMAN Unconventional myosin-XVB OS=Homo sapiens GN=MYO15B PE=1 SV=2 480 657 2.0E-12
sp|Q9Y6X6|MYO16_HUMAN Unconventional myosin-XVI OS=Homo sapiens GN=MYO16 PE=2 SV=3 576 729 6.0E-12
sp|Q5DU14|MYO16_MOUSE Unconventional myosin-XVI OS=Mus musculus GN=Myo16 PE=1 SV=2 576 753 2.0E-10
sp|Q9TW28|MYOM_DICDI Myosin-M heavy chain OS=Dictyostelium discoideum GN=myoM PE=1 SV=1 591 761 5.0E-10
sp|Q9ERC1|MYO16_RAT Unconventional myosin-XVI OS=Rattus norvegicus GN=Myo16 PE=1 SV=1 576 753 2.0E-09
[Show less]

GO

GO Term Description Terminal node
GO:0003774 cytoskeletal motor activity Yes
GO:0016459 myosin complex Yes
GO:0005524 ATP binding Yes
GO:1901265 nucleoside phosphate binding No
GO:0032555 purine ribonucleotide binding No
GO:0005488 binding No
GO:0036094 small molecule binding No
GO:1901363 heterocyclic compound binding No
GO:0097159 organic cyclic compound binding No
GO:0032991 protein-containing complex No
GO:0030554 adenyl nucleotide binding No
GO:0017076 purine nucleotide binding No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0043167 ion binding No
GO:0032559 adenyl ribonucleotide binding No
GO:0000166 nucleotide binding No
GO:0043168 anion binding No
GO:0032553 ribonucleotide binding No
GO:0003674 molecular_function No
GO:0005575 cellular_component No
GO:0097367 carbohydrate derivative binding No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm 0.7097 0.2172 0.1173 0.2903 0.2472 0.0065 0.1422 0.0912 0.0469 0.0016

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup3714
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5882
Ophiocordyceps australis map64 (Brazil) OphauB2|1965
Ophiocordyceps camponoti-floridani Ophcf2|03276
Ophiocordyceps camponoti-rufipedis Ophun1|7301
Ophiocordyceps kimflemingae Ophio5|8077
Ophiocordyceps subramaniannii Hirsu2|7236 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|7236
MGISRRPKNKSAQNAQPGATGAQRGGGARPKKATFEVTKKKEIGVSDLTLLSKVSNEAINENLKKRFEGAEIYTY
IGHVLVSVNPFRDLGIYTDQVLDSYKGKNRLEMPPHVFAIAESAYYNMKAYKDNQCVIISGESGAGKTEAAKRIM
QYIASVSGEQSGDIKKIKEMVLATNPLLESFGNAKTLRNNNSSRFGKYLQIHFNSTGEPVGADITNYLLEKTRVV
GQITNERNFHIFYQFTKGASQQYRELFGIQRPETYVYTSRSKCFDVDGIDDVAEFQDTINAMNVIGVSKSEQDDI
FRMLAAVLWIGNIHFQEDDSGYAAVADQSVVDFVAYLLEVTPQQVIHAITIRILTPRSGEVIESPGNPAQASATR
DALAKAIYNNLFDWIVARINKSLKSRQATANSIGILDIYGFEIFEKNSFEQLCINYVNEKLQQIFIQLTLKTEQE
EYAREKIQWTPIKYFDNKVVCDLIEQIRPPGVFSAMKDATKTAHADPAACDRTFMQSINGMSHAHLTPRQGNFII
KHYAGDVSYTVDGITDKNKDQLLKGLLNLFQESGVQFIQTLFPHQVDQDNRKQPPSAGDRIRSSANALVDTLMKC
QPSYIRTIKPNENKSPTEYNGSNVLHQIKYLGLQENVRIRRAGFAYRQAFDKFVDRFFLLSPATSYAGEYTWQGS
YEDAVRQILKDTSIPKEEWQLGVTKAFVKSPETLFALEHMRDRYWHNMATRIQRMWRAYLAYRAESATRIQRMWR
KKRTGAEFLQLRDQSHRVLQGRKERRRMSLLGSRRFLGDYLGVNASVGPGAQVRNAAGVASNERAVFSCRGEVLE
AKFGRSSKPSPRTIIVTNSKFYIIAQLLVEGKPQISVERAIPLGSIKFIGVSTCQDDWFSLGVGA*
Coding >Hirsu2|7236
ATGGGTATATCAAGGCGTCCGAAGAACAAGTCCGCCCAGAATGCTCAGCCCGGAGCGACGGGCGCCCAACGCGGC
GGCGGCGCCAGGCCCAAGAAGGCCACGTTTGAGGTGACCAAGAAGAAGGAGATCGGTGTTTCCGACTTGACTCTT
CTGAGCAAGGTTTCCAACGAGGCCATCAACGAGAACCTCAAGAAGCGCTTTGAGGGCGCCGAGATCTACACCTAC
ATCGGCCATGTCCTCGTCTCCGTCAACCCCTTTCGAGACCTGGGCATCTATACCGATCAAGTACTCGACAGCTAC
AAGGGGAAGAATCGTCTCGAGATGCCCCCGCACGTCTTCGCCATCGCCGAGTCTGCCTACTACAACATGAAGGCC
TACAAGGATAACCAGTGCGTCATCATTTCGGGCGAGTCTGGCGCCGGCAAGACCGAGGCTGCCAAGCGCATCATG
CAATACATTGCCAGCGTTTCCGGTGAGCAGTCGGGCGACATCAAGAAGATCAAGGAAATGGTGCTGGCCACGAAT
CCCCTGCTTGAGTCGTTTGGAAACGCAAAGACGCTACGTAACAACAACTCGTCGCGCTTCGGCAAGTACCTCCAA
ATTCACTTCAACTCGACGGGCGAACCTGTCGGGGCCGACATCACCAACTACCTGCTCGAAAAGACGCGCGTCGTC
GGCCAGATCACGAACGAGAGAAACTTCCACATCTTCTATCAGTTCACAAAGGGCGCCTCGCAGCAGTACCGGGAG
CTCTTCGGAATTCAACGGCCCGAGACCTACGTCTACACAAGCCGCTCCAAGTGTTTCGATGTCGATGGCATCGAC
GATGTTGCCGAATTCCAGGACACGATCAACGCCATGAACGTCATCGGGGTGAGCAAATCTGAGCAGGACGATATC
TTCCGGATGCTGGCAGCTGTCCTGTGGATTGGGAATATTCACTTCCAGGAAGATGACAGTGGCTATGCCGCCGTC
GCCGACCAGTCGGTCGTGGACTTCGTGGCATACCTCCTGGAGGTGACGCCCCAGCAAGTCATTCACGCCATCACC
ATCCGCATCCTCACTCCTCGCAGCGGCGAGGTGATCGAGTCTCCGGGGAACCCCGCTCAAGCGTCTGCTACGCGA
GATGCCCTGGCCAAAGCCATCTACAACAATCTTTTCGACTGGATTGTCGCGCGCATCAACAAGTCGCTCAAGTCT
CGGCAGGCGACGGCCAATTCCATTGGCATCCTGGATATCTACGGTTTTGAGATCTTCGAGAAAAATAGTTTCGAG
CAGCTTTGCATCAACTACGTCAACGAGAAGTTGCAGCAAATCTTCATCCAGCTCACCCTCAAGACGGAGCAGGAG
GAATACGCCAGGGAGAAGATCCAATGGACCCCCATTAAATACTTTGACAACAAGGTCGTGTGCGACCTGATTGAG
CAGATCAGACCACCCGGTGTTTTCTCTGCTATGAAGGATGCTACAAAGACAGCCCATGCCGACCCGGCCGCCTGT
GATAGGACTTTTATGCAGAGCATCAACGGCATGTCTCATGCCCACCTCACCCCTCGCCAGGGCAACTTCATCATC
AAACACTATGCTGGTGACGTCTCCTATACCGTTGACGGCATCACCGACAAGAACAAGGATCAGCTCCTCAAAGGC
CTGCTTAACCTTTTCCAGGAAAGCGGCGTCCAGTTCATCCAAACCCTATTCCCTCACCAGGTCGACCAGGACAAC
CGAAAACAGCCACCGTCCGCTGGAGACCGGATCCGCAGCTCGGCCAACGCGTTGGTGGACACGCTCATGAAATGT
CAACCGTCCTACATTCGGACCATTAAGCCCAACGAGAACAAATCTCCCACAGAATACAACGGCTCCAATGTGCTT
CACCAAATCAAGTACCTGGGCCTCCAGGAGAATGTGCGGATTCGCCGTGCCGGATTCGCATATCGCCAGGCATTC
GACAAGTTTGTCGACCGCTTCTTCCTGCTGTCGCCCGCGACCTCGTATGCCGGTGAATATACTTGGCAAGGCTCG
TACGAGGATGCCGTGAGACAGATTCTCAAGGACACCAGCATTCCTAAAGAGGAGTGGCAACTCGGCGTCACGAAA
GCTTTCGTCAAATCACCCGAGACTCTCTTCGCTCTGGAGCACATGAGAGACCGATATTGGCACAACATGGCCACC
CGCATCCAGAGAATGTGGCGTGCGTATCTCGCATACCGTGCCGAATCGGCCACTAGGATACAGCGGATGTGGAGG
AAAAAGCGGACTGGGGCCGAGTTCCTGCAGCTTCGTGATCAGAGCCATCGTGTCCTTCAGGGGAGAAAGGAAAGA
AGGCGTATGAGTCTGTTGGGCTCTCGCAGGTTCCTTGGCGACTACCTGGGCGTCAACGCCTCTGTCGGTCCTGGC
GCTCAGGTCCGCAACGCCGCCGGCGTTGCATCCAACGAGCGAGCCGTGTTTTCCTGTCGCGGCGAGGTGCTCGAG
GCCAAGTTTGGTCGATCCAGCAAGCCGAGCCCCCGCACTATCATCGTCACCAACAGCAAATTCTACATCATCGCT
CAGCTACTCGTCGAAGGCAAGCCCCAAATTTCCGTGGAGAGGGCCATCCCTCTCGGCTCCATCAAGTTCATCGGA
GTCTCCACGTGCCAGGACGATTGGTTCTCGCTGGGGGTTGGCGCGTGA
Transcript >Hirsu2|7236
ATGGGTATATCAAGGCGTCCGAAGAACAAGTCCGCCCAGAATGCTCAGCCCGGAGCGACGGGCGCCCAACGCGGC
GGCGGCGCCAGGCCCAAGAAGGCCACGTTTGAGGTGACCAAGAAGAAGGAGATCGGTGTTTCCGACTTGACTCTT
CTGAGCAAGGTTTCCAACGAGGCCATCAACGAGAACCTCAAGAAGCGCTTTGAGGGCGCCGAGATCTACACCTAC
ATCGGCCATGTCCTCGTCTCCGTCAACCCCTTTCGAGACCTGGGCATCTATACCGATCAAGTACTCGACAGCTAC
AAGGGGAAGAATCGTCTCGAGATGCCCCCGCACGTCTTCGCCATCGCCGAGTCTGCCTACTACAACATGAAGGCC
TACAAGGATAACCAGTGCGTCATCATTTCGGGCGAGTCTGGCGCCGGCAAGACCGAGGCTGCCAAGCGCATCATG
CAATACATTGCCAGCGTTTCCGGTGAGCAGTCGGGCGACATCAAGAAGATCAAGGAAATGGTGCTGGCCACGAAT
CCCCTGCTTGAGTCGTTTGGAAACGCAAAGACGCTACGTAACAACAACTCGTCGCGCTTCGGCAAGTACCTCCAA
ATTCACTTCAACTCGACGGGCGAACCTGTCGGGGCCGACATCACCAACTACCTGCTCGAAAAGACGCGCGTCGTC
GGCCAGATCACGAACGAGAGAAACTTCCACATCTTCTATCAGTTCACAAAGGGCGCCTCGCAGCAGTACCGGGAG
CTCTTCGGAATTCAACGGCCCGAGACCTACGTCTACACAAGCCGCTCCAAGTGTTTCGATGTCGATGGCATCGAC
GATGTTGCCGAATTCCAGGACACGATCAACGCCATGAACGTCATCGGGGTGAGCAAATCTGAGCAGGACGATATC
TTCCGGATGCTGGCAGCTGTCCTGTGGATTGGGAATATTCACTTCCAGGAAGATGACAGTGGCTATGCCGCCGTC
GCCGACCAGTCGGTCGTGGACTTCGTGGCATACCTCCTGGAGGTGACGCCCCAGCAAGTCATTCACGCCATCACC
ATCCGCATCCTCACTCCTCGCAGCGGCGAGGTGATCGAGTCTCCGGGGAACCCCGCTCAAGCGTCTGCTACGCGA
GATGCCCTGGCCAAAGCCATCTACAACAATCTTTTCGACTGGATTGTCGCGCGCATCAACAAGTCGCTCAAGTCT
CGGCAGGCGACGGCCAATTCCATTGGCATCCTGGATATCTACGGTTTTGAGATCTTCGAGAAAAATAGTTTCGAG
CAGCTTTGCATCAACTACGTCAACGAGAAGTTGCAGCAAATCTTCATCCAGCTCACCCTCAAGACGGAGCAGGAG
GAATACGCCAGGGAGAAGATCCAATGGACCCCCATTAAATACTTTGACAACAAGGTCGTGTGCGACCTGATTGAG
CAGATCAGACCACCCGGTGTTTTCTCTGCTATGAAGGATGCTACAAAGACAGCCCATGCCGACCCGGCCGCCTGT
GATAGGACTTTTATGCAGAGCATCAACGGCATGTCTCATGCCCACCTCACCCCTCGCCAGGGCAACTTCATCATC
AAACACTATGCTGGTGACGTCTCCTATACCGTTGACGGCATCACCGACAAGAACAAGGATCAGCTCCTCAAAGGC
CTGCTTAACCTTTTCCAGGAAAGCGGCGTCCAGTTCATCCAAACCCTATTCCCTCACCAGGTCGACCAGGACAAC
CGAAAACAGCCACCGTCCGCTGGAGACCGGATCCGCAGCTCGGCCAACGCGTTGGTGGACACGCTCATGAAATGT
CAACCGTCCTACATTCGGACCATTAAGCCCAACGAGAACAAATCTCCCACAGAATACAACGGCTCCAATGTGCTT
CACCAAATCAAGTACCTGGGCCTCCAGGAGAATGTGCGGATTCGCCGTGCCGGATTCGCATATCGCCAGGCATTC
GACAAGTTTGTCGACCGCTTCTTCCTGCTGTCGCCCGCGACCTCGTATGCCGGTGAATATACTTGGCAAGGCTCG
TACGAGGATGCCGTGAGACAGATTCTCAAGGACACCAGCATTCCTAAAGAGGAGTGGCAACTCGGCGTCACGAAA
GCTTTCGTCAAATCACCCGAGACTCTCTTCGCTCTGGAGCACATGAGAGACCGATATTGGCACAACATGGCCACC
CGCATCCAGAGAATGTGGCGTGCGTATCTCGCATACCGTGCCGAATCGGCCACTAGGATACAGCGGATGTGGAGG
AAAAAGCGGACTGGGGCCGAGTTCCTGCAGCTTCGTGATCAGAGCCATCGTGTCCTTCAGGGGAGAAAGGAAAGA
AGGCGTATGAGTCTGTTGGGCTCTCGCAGGTTCCTTGGCGACTACCTGGGCGTCAACGCCTCTGTCGGTCCTGGC
GCTCAGGTCCGCAACGCCGCCGGCGTTGCATCCAACGAGCGAGCCGTGTTTTCCTGTCGCGGCGAGGTGCTCGAG
GCCAAGTTTGGTCGATCCAGCAAGCCGAGCCCCCGCACTATCATCGTCACCAACAGCAAATTCTACATCATCGCT
CAGCTACTCGTCGAAGGCAAGCCCCAAATTTCCGTGGAGAGGGCCATCCCTCTCGGCTCCATCAAGTTCATCGGA
GTCTCCACGTGCCAGGACGATTGGTTCTCGCTGGGGGTTGGCGCGTGA
Gene >Hirsu2|7236
ATGGTAAGGAGCCTGCCTCGCTGGTCGTGGTTGCAATGAGCACTCATCTCCAATAGGGTATATCAAGGCGTCCGA
AGAACAAGTCCGCCCAGAATGCTCAGCCCGGAGCGACGGGCGCCCAACGCGGCGGCGGCGCCAGGCCCAAGAAGG
CCACGTTTGAGGTGACCAAGAAGAAGGAGATCGGTGTTTCCGACTTGACTCTTCTGAGCAAGGTTTCCAACGAGG
CCATCAACGAGAACCTCAAGAAGCGCTTTGAGGGCGCCGAGATCTACACCTACATCGGCCATGTCCTCGTCTCCG
TCAACCCCTTTCGAGACCTGGGCATCTATACCGATCAAGTACTCGACAGCTACAAGGGGAAGAATCGTCTCGAGA
TGCCCCCGCACGTCTTCGCCATCGCCGAGTCTGCCTACTACAACATGAAGGCCTACAAGGATAACCAGTGCGTCA
TCATTTCGGGCGAGTCTGGCGCCGGCAAGACCGAGGCTGCCAAGCGCATCATGCAATACATTGCCAGCGTTTCCG
GTGAGCAGTCGGGCGACATCAAGAAGATCAAGGAAATGGTGCTGGCCACGAATCCCCTGCTTGAGTCGTTTGGAA
ACGCAAAGACGCTACGTAACAACAACTCGTCGCGCTTCGGCAAGTACCTCCAAATTCACTTCAACTCGACGGGCG
AACCTGTCGGGGCCGACATCACCAACTACCTGCTCGAAAAGACGCGCGTCGTCGGCCAGATCACGAACGAGAGAA
ACTTCCACATCTTCTATCAGTTCACAAAGGGCGCCTCGCAGCAGTACCGGGAGCTCTTCGGAATTCAACGGCCCG
AGACCTACGTCTACACAAGCCGCTCCAAGTGTTTCGATGTCGATGGCATCGACGATGTTGCCGAATTCCAGGACA
CGATCAACGCCATGAACGTCATCGGGGTGAGCAAATCTGAGCAGGACGATATCTTCCGGATGCTGGCAGCTGTCC
TGTGGATTGGGAATATTCACTTCCAGGAAGATGACAGTGGCTATGCCGCCGTCGCCGACCAGTCGGTCGTGGACT
TCGTGGCATACCTCCTGGAGGTGACGCCCCAGCAAGTCATTCACGCCATCACCATCCGCATCCTCACTCCTCGCA
GCGGCGAGGTGATCGAGTCTCCGGGGAACCCCGCTCAAGCGTCTGCTACGCGAGATGCCCTGGCCAAAGCCATCT
ACAACAATCTTTTCGACTGGATTGTCGCGCGCATCAACAAGTCGCTCAAGTCTCGGCAGGCGACGGCCAATTCCA
TTGGCATCCTGGATATCTACGGTTTTGAGATCTTCGAGAAAAATAGTTTCGAGCAGCTTTGCATCAACTACGTCA
ACGAGAAGTTGCAGCAAATCTTCATCCAGCTCACCCTCAAGACGGAGCAGGAGGAATACGCCAGGGAGAAGATCC
AATGGACCCCCATTAAATACTTTGACAACAAGGTCGTGTGCGACCTGATTGAGCAGATCAGACCACCCGGTGTTT
TCTCTGCTATGAAGGATGCTACAAAGACAGCCCATGCCGACCCGGCCGCCTGTGATAGGACTTTTATGCAGAGCA
TCAACGGCATGTCTCATGCCCACCTCACCCCTCGCCAGGGCAACTTCATCATCAAACACTATGCTGGTGACGTCT
CCTATACCGTTGACGGCATCACCGACAAGAACAAGGATCAGCTCCTCAAAGGCCTGCTTAACCTTTTCCAGGAAA
GCGGCGTCCAGTTCATCCAAACCCTATTCCCTCACCAGGTCGACCAGGACAACCGAAAACAGCCACCGTCCGCTG
GAGACCGGATCCGCAGCTCGGCCAACGCGTTGGTGGACACGCTCATGAAATGTCAACCGTCCTACATTCGGACCA
TTAAGCCCAACGAGAACAAATCTCCCACAGAATACAACGGCTCCAATGTGCTTCACCAAATCAAGTACCTGGGCC
TCCAGGAGAATGTGCGGATTCGCCGTGCCGGATTCGCATATCGCCAGGCATTCGACAAGTTTGTCGACCGCTTCT
TCCTGCTGTCGCCCGCGACCTCGTATGCCGGTGAATATACTTGGCAAGGCTCGTACGAGGATGCCGTGAGACAGA
TTCTCAAGGACACCAGCATTCCTAAAGAGGAGTGGCAACTCGGCGTCACGAAAGCTTTCGTCAAATCACCCGAGA
CTCTCTTCGCTCTGGAGCACATGAGAGACCGATATTGGCACAACATGGCCACCCGCATCCAGAGAATGTGGCGTG
CGTATCTCGCATACCGTGCCGAATCGGCCACTAGGATACAGCGGATGTGGAGGAAAAAGCGGACTGGGGCCGAGT
TCCTGCAGCTTCGTGATCAGAGCCATCGTGTCCTTCAGGGGAGAAAGGAAAGAAGGCGTATGAGTCTGTTGGGCT
CTCGCAGGTTCCTTGGCGACTACCTGGGCGTCAACGCCTCTGTCGGTCCTGGCGCTCAGGTCCGCAACGCCGCCG
GCGTTGCATCCAACGAGCGAGCCGTGTTTTCCTGTCGCGGCGAGGTGCTCGAGGCCAAGTTTGGTCGATCCAGCA
AGCCGAGCCCCCGCACTATCATCGTCACCAACAGCAAATTCTACATCATCGCTCAGCTACTCGTCGAAGGCAAGC
CCCAAATTTCCGTGGAGAGGGCCATCCCTCTCGGCTCCATCAAGTTCATCGGAGTCTCCACGTGCCAGGACGATT
GGTTCTCGCTGGGGGTTGGGTCAGCTCAGGAGCCCGATCCCCTGATGAATTGCGTCTTTAAGACGGAAATGTTCA
CGCAAATGCAGCGCGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail