Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|7213
Gene name
LocationContig_407:16880..19448
Strand+
Gene length (bp)2568
Transcript length (bp)2256
Coding sequence length (bp)2256
Protein length (aa) 752

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00732 GMC_oxred_N GMC oxidoreductase 6.4E-45 219 492
PF05199 GMC_oxred_C GMC oxidoreductase 1.3E-29 573 730
PF00890 FAD_binding_2 FAD binding domain 2.7E-06 219 251

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|B5WWZ9|FAO2_LOTJA Long-chain-alcohol oxidase FAO2 OS=Lotus japonicus GN=FAO2 PE=2 SV=1 208 740 7.0E-85
sp|B5WWZ8|FAO1_LOTJA Long-chain-alcohol oxidase FAO1 OS=Lotus japonicus GN=FAO1 PE=1 SV=1 205 740 2.0E-71
sp|Q9LW56|FAO3_ARATH Long-chain-alcohol oxidase FAO3 OS=Arabidopsis thaliana GN=FAO3 PE=1 SV=1 236 743 1.0E-70
sp|Q94BP3|FAO4B_ARATH Long-chain-alcohol oxidase FAO4B OS=Arabidopsis thaliana GN=FAO4B PE=2 SV=2 112 740 1.0E-64
sp|Q9ZWB9|FAO1_ARATH Long-chain-alcohol oxidase FAO1 OS=Arabidopsis thaliana GN=FAO1 PE=3 SV=2 236 737 6.0E-60
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|B5WWZ9|FAO2_LOTJA Long-chain-alcohol oxidase FAO2 OS=Lotus japonicus GN=FAO2 PE=2 SV=1 208 740 7.0E-85
sp|B5WWZ8|FAO1_LOTJA Long-chain-alcohol oxidase FAO1 OS=Lotus japonicus GN=FAO1 PE=1 SV=1 205 740 2.0E-71
sp|Q9LW56|FAO3_ARATH Long-chain-alcohol oxidase FAO3 OS=Arabidopsis thaliana GN=FAO3 PE=1 SV=1 236 743 1.0E-70
sp|Q94BP3|FAO4B_ARATH Long-chain-alcohol oxidase FAO4B OS=Arabidopsis thaliana GN=FAO4B PE=2 SV=2 112 740 1.0E-64
sp|Q9ZWB9|FAO1_ARATH Long-chain-alcohol oxidase FAO1 OS=Arabidopsis thaliana GN=FAO1 PE=3 SV=2 236 737 6.0E-60
sp|O65709|FAO4A_ARATH Long-chain-alcohol oxidase FAO4A OS=Arabidopsis thaliana GN=FAO4A PE=3 SV=2 236 737 5.0E-59
sp|P9WMV7|Y492_MYCTU Uncharacterized GMC-type oxidoreductase Rv0492c OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv0492c PE=1 SV=1 219 729 5.0E-39
sp|P9WMV6|Y492_MYCTO Uncharacterized GMC-type oxidoreductase MT0511/MT0512 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT0511/MT0512 PE=3 SV=1 219 729 5.0E-39
sp|P55582|Y4NJ_RHISN Uncharacterized GMC-type oxidoreductase y4nJ OS=Rhizobium sp. (strain NGR234) GN=NGR_a02320 PE=3 SV=1 215 733 2.0E-23
sp|B5ZUG2|BETA_RHILW Oxygen-dependent choline dehydrogenase OS=Rhizobium leguminosarum bv. trifolii (strain WSM2304) GN=betA PE=3 SV=1 216 478 3.0E-06
sp|Q2MF66|LIVQ_STRLV 6'''-hydroxyparomomycin C oxidase OS=Streptomyces lividus GN=livQ PE=1 SV=1 674 740 7.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0055114 oxidation-reduction process Yes
GO:0016614 oxidoreductase activity, acting on CH-OH group of donors Yes
GO:0050660 flavin adenine dinucleotide binding Yes
GO:1901265 nucleoside phosphate binding No
GO:0050662 coenzyme binding No
GO:0005488 binding No
GO:0003824 catalytic activity No
GO:0043168 anion binding No
GO:0003674 molecular_function No
GO:0097159 organic cyclic compound binding No
GO:0043167 ion binding No
GO:0000166 nucleotide binding No
GO:0036094 small molecule binding No
GO:0008150 biological_process No
GO:0048037 cofactor binding No
GO:1901363 heterocyclic compound binding No
GO:0008152 metabolic process No
GO:0016491 oxidoreductase activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 46 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|7213
MDIPPQHAPVATPLPEPPSGQLVSETQWDTLLALLDGCMPAIASAAAGSADPDKLLLDPDRFRATLDSADRFLQG
PPDRKALEAFLAHSPSRAADFKAACLRFLASTPHRDRLLRIMGLLGTNYGSLLLTGYWTPVAQQPTETREAIVSS
WASSSFAALRMLAKAVTSMAQNANAVSSPYFQQLSGYTDVPRNWAAVDGYPFRFLQLDAGDAVHEMTTDVVVVGS
GCGGAVSARNLAEAGHRVLVVEKGYHFPPSHLPMPQAAACSYLFDNGGALVSDDASINVLSGGALGGGGTVNWSV
CFRTPHSVRDEWAAAGLPLFASADFDDCLDRVWESIGASTDGIRHNHRNRSMLDGCRKLAWLAAPVEQNTGDREH
ACGQCHLGCGSAEKRGPTVAWLPAAAEAGAQLMEGFQVDRVTFAADGVTATGVEGLWTSRGPGGDLGAPPTSRTQ
RRVRIKASRVILSAGSLWSPVILMKSGVENRNVGRNLHLHPCNLVSGAYKEDVRPWEGSIITTYSDEFADLDCKG
HGVKLEPSCMVPYMALSMQTWLGGLDARMLALKYRHMDCFVALTRDRDSGRVYVDRRTGRPRIDYTISDFDRDHT
LEGVQALAKICYVTGATEIRAGLPGLAPFVVEDGGERQRKHPEGRDPEFTDAAFGAWLARLRAADNKPPAAVFGS
AHQMGSCRMSADESSGVVDGQGRVWGREGLYVADASVFPSASGVNPMVTAMALADWISRGVARELGGGGGGGGGR
G*
Coding >Hirsu2|7213
ATGGACATACCGCCCCAGCACGCGCCCGTGGCCACGCCGCTGCCCGAGCCTCCCTCGGGCCAGCTCGTGTCCGAG
ACGCAGTGGGACACGCTCCTGGCCCTCCTCGACGGCTGCATGCCCGCCATCGCCTCCGCCGCCGCCGGCTCGGCC
GACCCGGACAAGCTTCTCCTCGACCCCGACCGCTTCCGCGCCACCCTCGACTCGGCCGACCGCTTCCTGCAAGGG
CCGCCCGACAGGAAGGCGCTCGAGGCCTTCCTCGCCCACAGCCCTTCGCGCGCCGCCGACTTCAAGGCCGCCTGC
CTGCGCTTCCTGGCCAGCACGCCGCATAGGGACCGCCTCCTCCGCATCATGGGCTTGCTAGGGACAAACTACGGC
AGCCTGCTCCTGACGGGCTACTGGACCCCCGTCGCCCAGCAGCCGACCGAGACACGCGAGGCCATCGTCAGCTCC
TGGGCCTCCTCCTCCTTCGCCGCCCTGCGCATGCTCGCCAAGGCCGTCACGTCGATGGCCCAGAACGCAAACGCC
GTCAGCAGCCCCTACTTCCAGCAGCTGTCGGGCTACACCGACGTGCCCCGGAACTGGGCCGCCGTCGACGGCTAC
CCCTTCCGCTTCCTCCAGCTCGACGCCGGCGACGCCGTGCACGAGATGACGACCGACGTCGTCGTCGTCGGCTCC
GGCTGCGGCGGCGCCGTCTCGGCCAGGAACCTGGCCGAGGCCGGCCACCGCGTCCTCGTCGTCGAGAAGGGCTAC
CACTTCCCGCCCTCGCACCTGCCCATGCCCCAGGCCGCCGCCTGCAGCTACCTCTTCGACAACGGCGGCGCCCTC
GTGTCCGACGACGCGAGCATCAACGTCCTCAGCGGCGGCGCCCTCGGCGGCGGCGGCACCGTCAACTGGAGCGTC
TGCTTCCGCACCCCGCACTCCGTCCGCGACGAGTGGGCCGCCGCCGGCCTGCCGCTCTTCGCCTCGGCCGACTTC
GACGACTGCCTCGACCGCGTCTGGGAGTCCATCGGCGCCAGCACCGACGGCATCCGCCACAACCACCGGAACCGG
AGCATGCTGGACGGCTGCCGCAAGCTGGCCTGGCTGGCCGCCCCGGTCGAGCAGAACACGGGCGACAGGGAGCAC
GCCTGCGGCCAGTGCCACCTGGGCTGCGGCTCGGCCGAGAAGAGGGGCCCGACGGTCGCCTGGCTGCCCGCCGCC
GCCGAGGCCGGCGCCCAGCTCATGGAGGGCTTCCAGGTCGACAGGGTCACCTTCGCCGCCGACGGCGTCACGGCC
ACGGGCGTCGAGGGGCTGTGGACGTCGCGCGGGCCCGGCGGCGACCTCGGCGCGCCCCCGACGTCGCGGACGCAG
AGGAGGGTCCGCATCAAGGCCAGCAGGGTCATCCTGTCCGCCGGCTCGCTCTGGAGCCCCGTCATCCTGATGAAG
AGCGGCGTCGAGAACCGGAACGTGGGCCGAAACCTGCACCTGCATCCTTGCAACCTGGTGTCGGGCGCGTACAAG
GAGGACGTGCGGCCGTGGGAGGGCAGCATCATCACCACCTACAGCGACGAGTTTGCGGACCTGGACTGCAAGGGT
CACGGCGTCAAGCTGGAGCCCTCGTGCATGGTGCCGTACATGGCCCTCAGCATGCAGACGTGGCTCGGCGGGCTG
GACGCCAGGATGCTGGCGCTCAAGTACCGGCACATGGACTGCTTCGTCGCGCTGACGCGCGACCGCGACAGCGGG
CGGGTGTACGTGGACCGGCGGACGGGACGGCCGCGGATCGACTACACCATCTCCGACTTCGACCGCGACCACACG
CTCGAGGGCGTGCAGGCGCTGGCCAAGATCTGCTACGTGACGGGGGCGACGGAGATCCGGGCGGGCCTGCCGGGG
CTGGCGCCGTTCGTGGTCGAGGACGGGGGCGAGCGGCAGCGGAAGCACCCGGAGGGCCGGGACCCCGAGTTCACG
GACGCGGCGTTCGGGGCGTGGCTGGCGCGGCTGCGGGCGGCGGACAACAAGCCGCCGGCGGCCGTGTTCGGGTCG
GCGCACCAGATGGGCTCGTGCCGGATGAGCGCCGACGAGTCGTCCGGGGTGGTGGACGGGCAGGGCCGGGTGTGG
GGCCGGGAGGGGCTGTACGTGGCCGACGCCAGCGTGTTTCCGAGCGCGAGCGGAGTGAACCCGATGGTGACGGCC
ATGGCCCTGGCCGACTGGATCTCGCGCGGCGTGGCCAGGGAGCTGGGTGGCGGCGGCGGCGGCGGCGGCGGCCGA
GGCTGA
Transcript >Hirsu2|7213
ATGGACATACCGCCCCAGCACGCGCCCGTGGCCACGCCGCTGCCCGAGCCTCCCTCGGGCCAGCTCGTGTCCGAG
ACGCAGTGGGACACGCTCCTGGCCCTCCTCGACGGCTGCATGCCCGCCATCGCCTCCGCCGCCGCCGGCTCGGCC
GACCCGGACAAGCTTCTCCTCGACCCCGACCGCTTCCGCGCCACCCTCGACTCGGCCGACCGCTTCCTGCAAGGG
CCGCCCGACAGGAAGGCGCTCGAGGCCTTCCTCGCCCACAGCCCTTCGCGCGCCGCCGACTTCAAGGCCGCCTGC
CTGCGCTTCCTGGCCAGCACGCCGCATAGGGACCGCCTCCTCCGCATCATGGGCTTGCTAGGGACAAACTACGGC
AGCCTGCTCCTGACGGGCTACTGGACCCCCGTCGCCCAGCAGCCGACCGAGACACGCGAGGCCATCGTCAGCTCC
TGGGCCTCCTCCTCCTTCGCCGCCCTGCGCATGCTCGCCAAGGCCGTCACGTCGATGGCCCAGAACGCAAACGCC
GTCAGCAGCCCCTACTTCCAGCAGCTGTCGGGCTACACCGACGTGCCCCGGAACTGGGCCGCCGTCGACGGCTAC
CCCTTCCGCTTCCTCCAGCTCGACGCCGGCGACGCCGTGCACGAGATGACGACCGACGTCGTCGTCGTCGGCTCC
GGCTGCGGCGGCGCCGTCTCGGCCAGGAACCTGGCCGAGGCCGGCCACCGCGTCCTCGTCGTCGAGAAGGGCTAC
CACTTCCCGCCCTCGCACCTGCCCATGCCCCAGGCCGCCGCCTGCAGCTACCTCTTCGACAACGGCGGCGCCCTC
GTGTCCGACGACGCGAGCATCAACGTCCTCAGCGGCGGCGCCCTCGGCGGCGGCGGCACCGTCAACTGGAGCGTC
TGCTTCCGCACCCCGCACTCCGTCCGCGACGAGTGGGCCGCCGCCGGCCTGCCGCTCTTCGCCTCGGCCGACTTC
GACGACTGCCTCGACCGCGTCTGGGAGTCCATCGGCGCCAGCACCGACGGCATCCGCCACAACCACCGGAACCGG
AGCATGCTGGACGGCTGCCGCAAGCTGGCCTGGCTGGCCGCCCCGGTCGAGCAGAACACGGGCGACAGGGAGCAC
GCCTGCGGCCAGTGCCACCTGGGCTGCGGCTCGGCCGAGAAGAGGGGCCCGACGGTCGCCTGGCTGCCCGCCGCC
GCCGAGGCCGGCGCCCAGCTCATGGAGGGCTTCCAGGTCGACAGGGTCACCTTCGCCGCCGACGGCGTCACGGCC
ACGGGCGTCGAGGGGCTGTGGACGTCGCGCGGGCCCGGCGGCGACCTCGGCGCGCCCCCGACGTCGCGGACGCAG
AGGAGGGTCCGCATCAAGGCCAGCAGGGTCATCCTGTCCGCCGGCTCGCTCTGGAGCCCCGTCATCCTGATGAAG
AGCGGCGTCGAGAACCGGAACGTGGGCCGAAACCTGCACCTGCATCCTTGCAACCTGGTGTCGGGCGCGTACAAG
GAGGACGTGCGGCCGTGGGAGGGCAGCATCATCACCACCTACAGCGACGAGTTTGCGGACCTGGACTGCAAGGGT
CACGGCGTCAAGCTGGAGCCCTCGTGCATGGTGCCGTACATGGCCCTCAGCATGCAGACGTGGCTCGGCGGGCTG
GACGCCAGGATGCTGGCGCTCAAGTACCGGCACATGGACTGCTTCGTCGCGCTGACGCGCGACCGCGACAGCGGG
CGGGTGTACGTGGACCGGCGGACGGGACGGCCGCGGATCGACTACACCATCTCCGACTTCGACCGCGACCACACG
CTCGAGGGCGTGCAGGCGCTGGCCAAGATCTGCTACGTGACGGGGGCGACGGAGATCCGGGCGGGCCTGCCGGGG
CTGGCGCCGTTCGTGGTCGAGGACGGGGGCGAGCGGCAGCGGAAGCACCCGGAGGGCCGGGACCCCGAGTTCACG
GACGCGGCGTTCGGGGCGTGGCTGGCGCGGCTGCGGGCGGCGGACAACAAGCCGCCGGCGGCCGTGTTCGGGTCG
GCGCACCAGATGGGCTCGTGCCGGATGAGCGCCGACGAGTCGTCCGGGGTGGTGGACGGGCAGGGCCGGGTGTGG
GGCCGGGAGGGGCTGTACGTGGCCGACGCCAGCGTGTTTCCGAGCGCGAGCGGAGTGAACCCGATGGTGACGGCC
ATGGCCCTGGCCGACTGGATCTCGCGCGGCGTGGCCAGGGAGCTGGGTGGCGGCGGCGGCGGCGGCGGCGGCCGA
GGCTGA
Gene >Hirsu2|7213
ATGGACATACCGCCCCAGCACGCGCCCGTGGCCACGCCGCTGCCCGAGCCTCCCTCGGGCCAGCTCGTGTCCGAG
ACGCAGTGGGACACGCTCCTGGCCCTCCTCGACGGCTGCATGCCCGCCATCGCCTCCGCCGCCGCCGGCTCGGCC
GACCCGGACAAGCTTCTCCTCGACCCCGACCGCTTCCGCGCCACCCTCGACTCGGCCGACCGCTTCCTGCAAGGG
CCGCCCGACAGGAAGGCGCTCGAGGCCTTCCTCGCCCACAGCCCTTCGCGCGCCGCCGACTTCAAGGCCGCCTGC
CTGCGCTTCCTGGCCAGCACGCCGCATAGGGACCGCCTCCTCCGCATCATGGGCTTGCTAGGGTGAGTCTTCGGT
TTTGTCCTGCCATCCCATCCCCGTCCCCGTCAGCCGGAGAGGCATCGGCGGCCACCACCACGCGCCCGAGCTGAC
GGGGCCGCCAGGACAAACTACGGCAGCCTGCTCCTGACGGGCTACTGGACCCCCGTCGCCCAGCAGCCGACCGAG
ACACGCGAGGCCATCGTCAGCTCCTGGGCCTCCTCCTCCTTCGCCGCCCTGCGCATGCTCGCCAAGGCCGTCACG
TCGATGGCCCAGAACGCAAACGCCGTCAGCAGCCCCTACTTCCAGCAGCTGTCGGGCTACACCGACGTGCCCCGG
AACTGGGCCGCCGTCGACGGCTACCCCTTCCGCTTCCTCCAGCTCGACGCCGGCGACGCCGTGCACGAGATGACG
ACCGACGTCGTCGTCGTCGGCTCCGGCTGCGGCGGCGCCGTCTCGGCCAGGAACCTGGCCGAGGCCGGCCACCGC
GTCCTCGTCGTCGAGAAGGGCTACCACTTCCCGCCCTCGCACCTGCCCATGCCCCAGGCCGCCGCCTGCAGCTAC
CTCTTCGACAACGGCGGCGCCCTCGTGTCCGACGACGCGAGCATCAACGTCCTCAGCGGCGGCGCCCTCGGCGGC
GGCGGCACCGTCAACTGGAGCGTCTGCTTCCGCACCCCGCACTCCGTCCGCGACGAGTGGGCCGCCGCCGGCCTG
CCGCTCTTCGCCTCGGCCGACTTCGACGACTGCCTCGACCGCGTCTGGGAGTCCATCGGCGCCAGCACCGACGGC
ATCCGCCACAACCACCGGAACCGGAGCATGCTGGACGGCTGCCGCAAGCTGGCCTGGCTGGCCGCCCCGGTCGAG
CAGAACACGGGCGACAGGGAGCACGCCTGCGGCCAGTGCCACCTGGGCTGCGGCTCGGCCGAGAAGAGGGGCCCG
ACGGTCGCCTGGCTGCCCGCCGCCGCCGAGGCCGGCGCCCAGCTCATGGAGGGCTTCCAGGTCGACAGGGTCACC
TTCGCCGCCGACGGCGTCACGGCCACGGGCGTCGAGGGGCTGTGGACGTCGCGCGGGCCCGGCGGCGACCTCGGC
GCGCCCCCGACGTCGCGGACGCAGAGGAGGGTCCGCATCAAGGCCAGCAGGGTCATCCTGTCCGCCGGCTCGCTC
TGGAGCCCCGTCATCCTGATGAAGAGCGGCGTCGAGGTGAGTCTGTCCAGCAACAGCAACAGGAGAAGGGACGGG
CAAAAAAAAAAAAAAAGGTGCCGATGGGGTCGACGCGACTGACGGCGGGCCGCGCAGAACCGGAACGTGGGCCGA
AACCTGCACCTGCATCCTTGCAACCTGGTGTCGGGCGCGTACAAGGAGGACGTGCGGCCGTGGGAGGGCAGCATC
ATCACCACCTACAGCGACGAGTTTGCGGACCTGGACTGCAAGGGTCACGGCGTCAAGCTGGAGCCCTCGTGCATG
GTGGTGAGTGGCCTGCCTCGTCTTTTCTCGAGCGAACCTGTCGTCTGTCCTCAAGGCGGAGAGAAGTTGTCGTCT
GTCCTAGAAGACGGGACAAGAGGCGGGGGCTGACCCGTGGACCAGCCGTACATGGCCCTCAGCATGCAGACGTGG
CTCGGCGGGCTGGACGCCAGGATGCTGGCGCTCAAGTACCGGCACATGGACTGCTTCGTCGCGCTGACGCGCGAC
CGCGACAGCGGGCGGGTGTACGTGGACCGGCGGACGGGACGGCCGCGGATCGACTACACCATCTCCGACTTCGAC
CGCGACCACACGCTCGAGGGCGTGCAGGCGCTGGCCAAGATCTGCTACGTGACGGGGGCGACGGAGATCCGGGCG
GGCCTGCCGGGGCTGGCGCCGTTCGTGGTCGAGGACGGGGGCGAGCGGCAGCGGAAGCACCCGGAGGGCCGGGAC
CCCGAGTTCACGGACGCGGCGTTCGGGGCGTGGCTGGCGCGGCTGCGGGCGGCGGACAACAAGCCGCCGGCGGCC
GTGTTCGGGTCGGCGCACCAGATGGGCTCGTGCCGGATGAGCGCCGACGAGTCGTCCGGGGTGGTGGACGGGCAG
GGCCGGGTGTGGGGCCGGGAGGGGCTGTACGTGGCCGACGCCAGCGTGTTTCCGAGCGCGAGCGGAGTGAACCCG
ATGGTGACGGCCATGGCCCTGGCCGACTGGATCTCGCGCGGCGTGGCCAGGGAGCTGGGTGGCGGCGGCGGCGGC
GGCGGCGGCCGAGGCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail