Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|7208
Gene name
LocationContig_407:5968..7179
Strand+
Gene length (bp)1211
Transcript length (bp)891
Coding sequence length (bp)891
Protein length (aa) 297

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12271 Chs7 Chitin synthase export chaperone 4.2E-113 6 291

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q6MYT0|CHS7_ASPFU Chitin synthase export chaperone OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=chs7 PE=3 SV=1 6 286 3.0E-37
sp|Q1DKX4|CHS7_COCIM Chitin synthase export chaperone OS=Coccidioides immitis (strain RS) GN=CHS7 PE=3 SV=1 5 286 1.0E-36
sp|Q5BEG1|CHS7_EMENI Chitin synthase export chaperone OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=chs7 PE=3 SV=1 6 286 1.0E-34
sp|Q2UNJ0|CHS7_ASPOR Chitin synthase export chaperone OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=chs7 PE=3 SV=1 6 286 2.0E-33
sp|A1CPR8|CHS7_ASPCL Chitin synthase export chaperone OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=chs7 PE=3 SV=1 6 286 4.0E-32
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q6MYT0|CHS7_ASPFU Chitin synthase export chaperone OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=chs7 PE=3 SV=1 6 286 3.0E-37
sp|Q1DKX4|CHS7_COCIM Chitin synthase export chaperone OS=Coccidioides immitis (strain RS) GN=CHS7 PE=3 SV=1 5 286 1.0E-36
sp|Q5BEG1|CHS7_EMENI Chitin synthase export chaperone OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=chs7 PE=3 SV=1 6 286 1.0E-34
sp|Q2UNJ0|CHS7_ASPOR Chitin synthase export chaperone OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=chs7 PE=3 SV=1 6 286 2.0E-33
sp|A1CPR8|CHS7_ASPCL Chitin synthase export chaperone OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=chs7 PE=3 SV=1 6 286 4.0E-32
sp|Q7SB92|CHS7_NEUCR Chitin synthase export chaperone OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=csc-1 PE=3 SV=1 5 286 9.0E-30
sp|Q4IJ79|CHS7_GIBZE Chitin synthase export chaperone OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=CHS7 PE=3 SV=2 4 286 9.0E-29
sp|Q5YCW8|CHS7_FUSO4 Chitin synthase export chaperone OS=Fusarium oxysporum f. sp. lycopersici (strain 4287 / CBS 123668 / FGSC 9935 / NRRL 34936) GN=chs7 PE=3 SV=1 4 286 1.0E-28
sp|Q2H7Q1|CHS7_CHAGB Chitin synthase export chaperone OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=CHS7 PE=3 SV=1 6 286 3.0E-28
sp|P0CM73|CHS7_CRYNB Chitin synthase export chaperone OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=CHS7 PE=3 SV=1 5 286 4.0E-28
sp|P0CM72|CHS7_CRYNJ Chitin synthase export chaperone OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=CHS7 PE=3 SV=1 5 286 6.0E-28
sp|Q0UDX8|CHS7_PHANO Chitin synthase export chaperone OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=CHS7 PE=3 SV=1 6 286 3.0E-27
sp|Q6C8U1|CHS7_YARLI Chitin synthase export chaperone OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=CHS7 PE=3 SV=1 6 286 3.0E-22
sp|Q6BUS8|CHS7_DEBHA Chitin synthase export chaperone OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=CHS7 PE=3 SV=1 6 286 6.0E-20
sp|Q5AA40|CHS7_CANAL Chitin synthase export chaperone OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CHS7 PE=3 SV=1 5 286 3.0E-19
sp|Q6FT25|CHS7_CANGA Chitin synthase export chaperone OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=CHS7 PE=3 SV=1 8 292 2.0E-18
sp|P38843|CHS7_YEAST Chitin synthase export chaperone OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CHS7 PE=1 SV=1 6 294 5.0E-16
sp|Q754N9|CHS7_ASHGO Chitin synthase export chaperone OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=CHS7 PE=3 SV=1 5 292 2.0E-11
sp|Q6CRM6|CHS7_KLULA Chitin synthase export chaperone OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=CHS7 PE=3 SV=1 6 292 1.0E-10
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 63 0.5

Transmembrane Domains

Domain # Start End Length
1 50 72 22
2 87 109 22
3 116 138 22
4 148 170 22
5 191 210 19
6 225 247 22
7 260 282 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|7208
MGSTDFGKFNDFCKDSTLPVCNLLSSPDHDQDGPWKGCQLRGISLSNDRHLGNLGSILLCGVAVAVAAFLMLKSE
KKRAAVGRREMQIFLIGYIIISICEIFSVGVFPLDKAVRIAFSGIHIGMIIATTWILMLNAIVGYQLIDDGTPLS
VGLMLLSAALLFIGTGYIALDTGYSWTGYWNSSFELPNRHVALYVLYQLAPLIFLVAFYVLETILVLRVLGEVRP
MLYLTAAAVVFAIGQVFNYAISKYICDGTSGKIDGALFQTLFTLLSVVLVWFFWSSITEDDWPMQTSGSYP*
Coding >Hirsu2|7208
ATGGGTTCGACAGACTTTGGAAAGTTCAACGACTTTTGCAAAGACTCGACCCTCCCGGTCTGCAATCTTCTCTCG
TCGCCCGACCACGACCAAGATGGGCCATGGAAAGGATGTCAACTGAGAGGCATCTCGTTGAGCAATGACCGCCAT
CTCGGCAACCTGGGCTCCATTCTCCTCTGCGGTGTCGCCGTCGCCGTCGCCGCCTTCCTGATGCTGAAATCGGAG
AAGAAACGGGCAGCAGTGGGCCGACGGGAAATGCAAATATTCCTCATCGGCTACATCATCATCAGCATATGCGAA
ATCTTCTCCGTCGGTGTCTTTCCACTCGACAAGGCGGTCCGAATAGCCTTCTCCGGCATTCACATCGGCATGATC
ATCGCCACCACCTGGATATTGATGCTCAACGCCATCGTCGGCTACCAGCTGATCGATGACGGCACGCCCCTGTCC
GTGGGGCTCATGCTACTCTCTGCAGCCCTCCTCTTCATCGGCACCGGCTACATCGCTCTCGATACAGGCTACAGC
TGGACCGGCTACTGGAACAGCAGCTTCGAGCTCCCGAATCGACACGTCGCCCTCTACGTGCTTTATCAGCTGGCG
CCCCTCATCTTCCTCGTCGCCTTTTACGTTCTCGAAACGATCCTGGTCTTGCGCGTGCTTGGCGAGGTCCGTCCC
ATGCTGTACCTGACCGCCGCCGCCGTCGTCTTCGCCATCGGCCAGGTCTTCAACTACGCCATCAGCAAGTACATA
TGTGATGGCACTAGCGGCAAGATCGACGGCGCACTCTTCCAGACCCTCTTCACACTACTCTCCGTCGTTCTCGTC
TGGTTCTTTTGGTCCAGCATCACCGAAGACGACTGGCCGATGCAGACGTCCGGCTCATACCCCTAA
Transcript >Hirsu2|7208
ATGGGTTCGACAGACTTTGGAAAGTTCAACGACTTTTGCAAAGACTCGACCCTCCCGGTCTGCAATCTTCTCTCG
TCGCCCGACCACGACCAAGATGGGCCATGGAAAGGATGTCAACTGAGAGGCATCTCGTTGAGCAATGACCGCCAT
CTCGGCAACCTGGGCTCCATTCTCCTCTGCGGTGTCGCCGTCGCCGTCGCCGCCTTCCTGATGCTGAAATCGGAG
AAGAAACGGGCAGCAGTGGGCCGACGGGAAATGCAAATATTCCTCATCGGCTACATCATCATCAGCATATGCGAA
ATCTTCTCCGTCGGTGTCTTTCCACTCGACAAGGCGGTCCGAATAGCCTTCTCCGGCATTCACATCGGCATGATC
ATCGCCACCACCTGGATATTGATGCTCAACGCCATCGTCGGCTACCAGCTGATCGATGACGGCACGCCCCTGTCC
GTGGGGCTCATGCTACTCTCTGCAGCCCTCCTCTTCATCGGCACCGGCTACATCGCTCTCGATACAGGCTACAGC
TGGACCGGCTACTGGAACAGCAGCTTCGAGCTCCCGAATCGACACGTCGCCCTCTACGTGCTTTATCAGCTGGCG
CCCCTCATCTTCCTCGTCGCCTTTTACGTTCTCGAAACGATCCTGGTCTTGCGCGTGCTTGGCGAGGTCCGTCCC
ATGCTGTACCTGACCGCCGCCGCCGTCGTCTTCGCCATCGGCCAGGTCTTCAACTACGCCATCAGCAAGTACATA
TGTGATGGCACTAGCGGCAAGATCGACGGCGCACTCTTCCAGACCCTCTTCACACTACTCTCCGTCGTTCTCGTC
TGGTTCTTTTGGTCCAGCATCACCGAAGACGACTGGCCGATGCAGACGTCCGGCTCATACCCCTAA
Gene >Hirsu2|7208
ATGGGTTCGACAGACTTTGGAAAGTTCAACGTACGTTGCGCTCGACACAAAAAAAAAAAAACGTACGACACGAAG
CTAACGTGTCTCGACGCCGGGCAGGACTTTTGCAAAGACTCGACCCTCCCGGTCTGCAATGTGCGTATCGCGATG
TTCATGTTCTCATCGCACAAGACTTCGGCTCCTTGCGCGTCCCTTGCTTCGCATGACAGCCGACAGACGATGCAC
CATGGACCCGCCGACTGACCTCAGCTTCTCCGTTGCAGCTTCTCTCGTCGCCCGACCACGACCAAGATGGGCCAT
GGAAAGGATGTCAACTGAGAGGCATCTCGTTGAGCAATGACCGCCATCTCGGCAACCTGGGCTCCATTCTCCTCT
GCGGTGTCGCCGTCGCCGTCGCCGCCTTCCTGATGCTGAAATCGGAGAAGAAACGGGCAGCAGTGGGCCGACGGT
ATGCCTCGTCATTCGCGCCGGGACCGACGCCAACCCTTAGCAGCCGACCAAACTGACGAATGACGCAACAGGGAA
ATGCAAATATTCCTCATCGGCTACATCATCATCAGCATATGCGAAATCTTCTCCGTCGGTGTCTTTCCACTCGAC
AAGGCGGTCCGAATAGTACGCCGACCCCCGCACTTCCAACCATCCGCATCGCTGACCACCCTCAGGCCTTCTCCG
GCATTCACATCGGCATGATCATCGCCACCACCTGGATATTGATGCTCAACGCCATCGTCGGCTACCAGCTGATCG
ATGACGGCACGCCCCTGTCCGTGGGGCTCATGCTACTCTCTGCAGCCCTCCTCTTCATCGGCACCGGCTACATCG
CTCTCGATACAGGCTACAGCTGGACCGGCTACTGGAACAGCAGCTTCGAGCTCCCGAATCGACACGTCGCCCTCT
ACGTGCTTTATCAGCTGGCGCCCCTCATCTTCCTCGTCGCCTTTTACGTTCTCGAAACGATCCTGGTCTTGCGCG
TGCTTGGCGAGGTCCGTCCCATGCTGTACCTGACCGCCGCCGCCGTCGTCTTCGCCATCGGCCAGGTCTTCAACT
ACGCCATCAGCAAGTACATATGTGATGGCACTAGCGGCAAGATCGACGGCGCACTCTTCCAGACCCTCTTCACAC
TACTCTCCGTCGTTCTCGTCTGGTTCTTTTGGTCCAGCATCACCGAAGACGACTGGCCGATGCAGACGTCCGGCT
CATACCCCTAA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail