Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|7207
Gene name
LocationContig_406:20324..20633
Strand-
Gene length (bp)309
Transcript length (bp)309
Coding sequence length (bp)309
Protein length (aa) 103

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm 0.644 0.4178 0.0501 0.092 0.4357 0.0204 0.0629 0.3586 0.2257 0.0057

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup413
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|129
Ophiocordyceps australis 1348a (Ghana) OphauG2|4186
Ophiocordyceps australis map64 (Brazil) OphauB2|6252
Ophiocordyceps australis map64 (Brazil) OphauB2|6352
Ophiocordyceps camponoti-floridani Ophcf2|00448
Ophiocordyceps camponoti-rufipedis Ophun1|1825
Ophiocordyceps kimflemingae Ophio5|6661
Ophiocordyceps subramaniannii Hirsu2|2771
Ophiocordyceps subramaniannii Hirsu2|7207 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|7207
MIDHHAGFVPAFLSCIRSAPLTDQHAAWSRLAARPPRSTAVLLAEADEIIDADLYTREGLPLAGGPTRVVWRVLP
GNHDFIMTHAANILRELDQLWDMKPPF*
Coding >Hirsu2|7207
ATGATCGACCACCACGCCGGCTTCGTCCCGGCCTTCCTCTCCTGCATCCGCTCCGCGCCCCTGACGGACCAGCAC
GCCGCCTGGAGCCGCCTCGCCGCCCGCCCGCCCCGCTCCACCGCCGTCCTGCTGGCCGAAGCCGACGAGATCATC
GACGCCGACCTCTACACCCGCGAGGGCCTGCCCCTTGCCGGCGGGCCCACCCGCGTCGTCTGGCGCGTCCTGCCC
GGCAACCACGACTTCATCATGACCCACGCCGCCAACATCCTGCGCGAGCTCGACCAGCTCTGGGACATGAAGCCG
CCATTCTGA
Transcript >Hirsu2|7207
ATGATCGACCACCACGCCGGCTTCGTCCCGGCCTTCCTCTCCTGCATCCGCTCCGCGCCCCTGACGGACCAGCAC
GCCGCCTGGAGCCGCCTCGCCGCCCGCCCGCCCCGCTCCACCGCCGTCCTGCTGGCCGAAGCCGACGAGATCATC
GACGCCGACCTCTACACCCGCGAGGGCCTGCCCCTTGCCGGCGGGCCCACCCGCGTCGTCTGGCGCGTCCTGCCC
GGCAACCACGACTTCATCATGACCCACGCCGCCAACATCCTGCGCGAGCTCGACCAGCTCTGGGACATGAAGCCG
CCATTCTGA
Gene >Hirsu2|7207
ATGATCGACCACCACGCCGGCTTCGTCCCGGCCTTCCTCTCCTGCATCCGCTCCGCGCCCCTGACGGACCAGCAC
GCCGCCTGGAGCCGCCTCGCCGCCCGCCCGCCCCGCTCCACCGCCGTCCTGCTGGCCGAAGCCGACGAGATCATC
GACGCCGACCTCTACACCCGCGAGGGCCTGCCCCTTGCCGGCGGGCCCACCCGCGTCGTCTGGCGCGTCCTGCCC
GGCAACCACGACTTCATCATGACCCACGCCGCCAACATCCTGCGCGAGCTCGACCAGCTCTGGGACATGAAGCCG
CCATTCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail