Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|7197
Gene name
LocationContig_405:85..2950
Strand+
Gene length (bp)2865
Transcript length (bp)2571
Coding sequence length (bp)2571
Protein length (aa) 857

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF14420 Clr5 Clr5 domain 7.9E-23 395 447

Swissprot hits

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus Nuclear localization signal 0.4496 0.723 0.2319 0.1274 0.1099 0.0203 0.0701 0.061 0.0294 0.0663

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup3697
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5130
Ophiocordyceps australis map64 (Brazil) OphauB2|1419
Ophiocordyceps camponoti-floridani Ophcf2|02232
Ophiocordyceps camponoti-rufipedis Ophun1|559
Ophiocordyceps kimflemingae Ophio5|5872
Ophiocordyceps subramaniannii Hirsu2|7197 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|7197
MDWTPSDDHVSPAYHHGSHAANDVELDALSPVQTGGGVGRLVAHFENKATAFRSIRSINSIRRIHSTSSIHSINS
IHSILITRSILINRSILTNRSIINHSILTNRSISFNSNININISNSINNSINNSIKINIKISININSSSSSSSSR
GSRPSPGPSSTTWPTSAPAPWASFGVQSRVTSPTAANSSPVSFAGFHQDASRVASPGNTPLSGQFAVLDDFVSGN
RVQSPAGPAAMSQMAPSPMVSPPAILSPTTQSSPPVPGTPGFEIWRPPGYVSIKSEAAPSAASIPRTSGYVKPPL
PTTPKPNLNTSGNQFILEFNPSAKAKGKAPAKPPRLRAPPLIPPPFSPEIKQEPVTPQVSDAPPPSTALPSVQRQ
ASVSLRAHAGPRPSREQVPAEAWEQFKSTIRTLYLDERRPLKEVMAIMAEKYNFQATPKMYKTRFSQWGFVKNNT
EDEVKRLLSMKFQRDAEGKVSEFVRNGRVVNLGTYLKRKGVTEYDLIDFELPADLPAHVKCRTPTPPPAPEYLRS
PDLLRAQELVVGNMRKAFLHCRQLEVETDAQIGWPVTMVWGAGSSDLLMEANFYFEARDADQGGHFLMRAFKQLE
VDLKKLSPLGIKELLLGMVQRDPGMMTALCKYLAAYSTTNLERSHPLRQIFTCLYEVQQKHGPGTLSDLLWGSIP
TIAEELEAIYSRRHPYVARAWIDLALFYNHVHPERLAKLVAELRGVERQLEQRHGANSVDVLTLRYSILQLLYAA
GPQSEPTKQAAVELWNHMRGLGVVFPVRDAKPNVYCYHSPVKVDPWTKRCRRRYDSGVAILEEHVGVKVLPYFEE
DFHTTVHAQDVQEAWSAALNHMQSSSKFAFI*
Coding >Hirsu2|7197
ATGGACTGGACGCCCTCCGACGACCATGTCTCGCCGGCCTACCATCACGGGAGCCACGCCGCCAATGATGTTGAG
CTGGATGCCCTGAGTCCCGTCCAGACGGGCGGCGGCGTCGGCCGCCTGGTCGCCCACTTCGAGAACAAGGCAACG
GCCTTCAGATCCATCCGCAGCATCAACAGCATCCGCCGCATCCACAGCACCAGCAGCATCCACAGCATCAACAGC
ATCCACAGCATCCTCATCACCCGCAGCATCCTCATCAACCGCAGCATCCTCACCAACCGCAGCATCATCAACCAC
AGCATCCTCACCAACCGCAGCATCAGCTTCAACAGCAACATCAACATCAACATCAGCAACAGCATCAACAACAGC
ATCAACAACAGCATCAAAATCAACATCAAAATCAGCATCAACATCAACAGCAGCAGCAGCAGCAGCAGCAGCCGG
GGCAGCAGGCCGTCTCCCGGTCCCAGTTCGACAACATGGCCTACTTCGGCCCCGGCCCCGTGGGCCTCCTTCGGC
GTCCAGTCGCGCGTCACGAGCCCGACGGCCGCCAACTCGTCGCCCGTCTCCTTCGCCGGCTTCCACCAGGACGCC
TCGCGCGTCGCCAGCCCGGGCAACACCCCCCTGTCCGGCCAGTTCGCCGTCCTCGACGACTTCGTGTCTGGGAAC
CGCGTCCAGAGCCCCGCCGGACCCGCCGCCATGTCCCAGATGGCCCCTTCTCCGATGGTCAGCCCCCCGGCCATC
CTGTCTCCGACGACCCAGTCGAGCCCCCCCGTGCCCGGGACGCCGGGCTTTGAAATCTGGCGGCCCCCGGGCTAC
GTCAGCATCAAGTCGGAGGCGGCCCCGTCGGCCGCTTCCATCCCGCGCACCAGCGGCTACGTCAAGCCACCCCTG
CCCACGACGCCGAAGCCGAATCTCAACACGTCCGGAAATCAGTTCATCCTCGAGTTTAACCCTAGCGCCAAGGCC
AAGGGAAAGGCCCCGGCCAAGCCGCCGAGGCTCCGCGCCCCTCCGCTCATCCCACCCCCTTTCAGCCCCGAGATC
AAACAGGAGCCGGTCACGCCCCAAGTATCCGACGCTCCACCGCCATCGACAGCTCTGCCCTCGGTTCAGAGGCAA
GCGTCCGTGTCTCTCCGCGCACACGCCGGCCCGCGGCCCTCGCGAGAGCAGGTCCCCGCAGAGGCCTGGGAGCAG
TTCAAGTCGACGATCCGAACGCTCTATCTCGATGAGAGGAGACCGCTCAAGGAGGTCATGGCCATCATGGCCGAA
AAGTACAATTTCCAGGCGACTCCGAAAATGTACAAGACGCGCTTCTCGCAATGGGGCTTCGTCAAGAACAACACC
GAGGACGAAGTCAAGAGGCTGCTGTCGATGAAGTTCCAGCGGGACGCCGAGGGCAAGGTGTCCGAGTTCGTCCGC
AACGGGCGGGTCGTCAACCTCGGCACCTATCTCAAGCGCAAAGGCGTGACCGAGTACGACCTGATCGACTTCGAG
CTGCCGGCCGACCTGCCGGCGCACGTCAAGTGCCGGACGCCGACGCCGCCGCCGGCGCCCGAGTACCTGCGGTCG
CCGGACCTCCTGCGGGCGCAGGAGCTGGTGGTGGGCAACATGCGCAAGGCCTTCTTGCACTGCCGGCAGCTCGAG
GTCGAGACGGACGCGCAGATCGGCTGGCCGGTGACAATGGTGTGGGGCGCCGGCTCGAGCGACCTGCTGATGGAG
GCCAACTTCTACTTCGAGGCCCGGGACGCCGACCAGGGCGGGCACTTCCTGATGCGGGCCTTCAAGCAGCTCGAG
GTGGACCTGAAGAAGCTGTCGCCGCTGGGGATCAAGGAGCTGCTGCTGGGCATGGTGCAGCGCGACCCGGGCATG
ATGACGGCGCTGTGCAAGTACCTGGCGGCCTACTCGACGACGAACCTGGAGCGGTCGCACCCGCTGCGGCAGATC
TTCACCTGCCTCTACGAGGTGCAGCAGAAGCACGGGCCCGGGACGCTGTCGGACCTGCTGTGGGGCAGCATCCCG
ACCATCGCGGAGGAGCTCGAGGCCATCTACAGCCGGCGGCACCCGTACGTGGCGCGGGCCTGGATCGACCTGGCC
CTCTTTTACAACCACGTGCACCCGGAGCGGCTGGCCAAGCTGGTGGCGGAGCTGCGCGGCGTCGAGCGGCAGCTG
GAGCAGCGGCACGGGGCCAACAGCGTCGACGTGCTGACGCTGCGCTACTCGATCCTGCAGCTGCTGTACGCGGCC
GGGCCGCAGTCGGAGCCGACGAAGCAGGCGGCCGTCGAGCTGTGGAACCACATGCGCGGCCTCGGCGTCGTCTTC
CCGGTCCGCGACGCCAAGCCCAACGTCTACTGCTACCACAGCCCGGTCAAGGTGGACCCGTGGACGAAGCGGTGC
CGGCGCCGGTACGACTCGGGCGTCGCCATCCTCGAGGAGCACGTCGGCGTCAAGGTGCTGCCCTACTTCGAGGAG
GACTTTCACACCACCGTCCACGCGCAGGACGTCCAGGAGGCCTGGTCGGCCGCGCTCAACCACATGCAGTCGTCC
AGCAAGTTTGCCTTTATCTAG
Transcript >Hirsu2|7197
ATGGACTGGACGCCCTCCGACGACCATGTCTCGCCGGCCTACCATCACGGGAGCCACGCCGCCAATGATGTTGAG
CTGGATGCCCTGAGTCCCGTCCAGACGGGCGGCGGCGTCGGCCGCCTGGTCGCCCACTTCGAGAACAAGGCAACG
GCCTTCAGATCCATCCGCAGCATCAACAGCATCCGCCGCATCCACAGCACCAGCAGCATCCACAGCATCAACAGC
ATCCACAGCATCCTCATCACCCGCAGCATCCTCATCAACCGCAGCATCCTCACCAACCGCAGCATCATCAACCAC
AGCATCCTCACCAACCGCAGCATCAGCTTCAACAGCAACATCAACATCAACATCAGCAACAGCATCAACAACAGC
ATCAACAACAGCATCAAAATCAACATCAAAATCAGCATCAACATCAACAGCAGCAGCAGCAGCAGCAGCAGCCGG
GGCAGCAGGCCGTCTCCCGGTCCCAGTTCGACAACATGGCCTACTTCGGCCCCGGCCCCGTGGGCCTCCTTCGGC
GTCCAGTCGCGCGTCACGAGCCCGACGGCCGCCAACTCGTCGCCCGTCTCCTTCGCCGGCTTCCACCAGGACGCC
TCGCGCGTCGCCAGCCCGGGCAACACCCCCCTGTCCGGCCAGTTCGCCGTCCTCGACGACTTCGTGTCTGGGAAC
CGCGTCCAGAGCCCCGCCGGACCCGCCGCCATGTCCCAGATGGCCCCTTCTCCGATGGTCAGCCCCCCGGCCATC
CTGTCTCCGACGACCCAGTCGAGCCCCCCCGTGCCCGGGACGCCGGGCTTTGAAATCTGGCGGCCCCCGGGCTAC
GTCAGCATCAAGTCGGAGGCGGCCCCGTCGGCCGCTTCCATCCCGCGCACCAGCGGCTACGTCAAGCCACCCCTG
CCCACGACGCCGAAGCCGAATCTCAACACGTCCGGAAATCAGTTCATCCTCGAGTTTAACCCTAGCGCCAAGGCC
AAGGGAAAGGCCCCGGCCAAGCCGCCGAGGCTCCGCGCCCCTCCGCTCATCCCACCCCCTTTCAGCCCCGAGATC
AAACAGGAGCCGGTCACGCCCCAAGTATCCGACGCTCCACCGCCATCGACAGCTCTGCCCTCGGTTCAGAGGCAA
GCGTCCGTGTCTCTCCGCGCACACGCCGGCCCGCGGCCCTCGCGAGAGCAGGTCCCCGCAGAGGCCTGGGAGCAG
TTCAAGTCGACGATCCGAACGCTCTATCTCGATGAGAGGAGACCGCTCAAGGAGGTCATGGCCATCATGGCCGAA
AAGTACAATTTCCAGGCGACTCCGAAAATGTACAAGACGCGCTTCTCGCAATGGGGCTTCGTCAAGAACAACACC
GAGGACGAAGTCAAGAGGCTGCTGTCGATGAAGTTCCAGCGGGACGCCGAGGGCAAGGTGTCCGAGTTCGTCCGC
AACGGGCGGGTCGTCAACCTCGGCACCTATCTCAAGCGCAAAGGCGTGACCGAGTACGACCTGATCGACTTCGAG
CTGCCGGCCGACCTGCCGGCGCACGTCAAGTGCCGGACGCCGACGCCGCCGCCGGCGCCCGAGTACCTGCGGTCG
CCGGACCTCCTGCGGGCGCAGGAGCTGGTGGTGGGCAACATGCGCAAGGCCTTCTTGCACTGCCGGCAGCTCGAG
GTCGAGACGGACGCGCAGATCGGCTGGCCGGTGACAATGGTGTGGGGCGCCGGCTCGAGCGACCTGCTGATGGAG
GCCAACTTCTACTTCGAGGCCCGGGACGCCGACCAGGGCGGGCACTTCCTGATGCGGGCCTTCAAGCAGCTCGAG
GTGGACCTGAAGAAGCTGTCGCCGCTGGGGATCAAGGAGCTGCTGCTGGGCATGGTGCAGCGCGACCCGGGCATG
ATGACGGCGCTGTGCAAGTACCTGGCGGCCTACTCGACGACGAACCTGGAGCGGTCGCACCCGCTGCGGCAGATC
TTCACCTGCCTCTACGAGGTGCAGCAGAAGCACGGGCCCGGGACGCTGTCGGACCTGCTGTGGGGCAGCATCCCG
ACCATCGCGGAGGAGCTCGAGGCCATCTACAGCCGGCGGCACCCGTACGTGGCGCGGGCCTGGATCGACCTGGCC
CTCTTTTACAACCACGTGCACCCGGAGCGGCTGGCCAAGCTGGTGGCGGAGCTGCGCGGCGTCGAGCGGCAGCTG
GAGCAGCGGCACGGGGCCAACAGCGTCGACGTGCTGACGCTGCGCTACTCGATCCTGCAGCTGCTGTACGCGGCC
GGGCCGCAGTCGGAGCCGACGAAGCAGGCGGCCGTCGAGCTGTGGAACCACATGCGCGGCCTCGGCGTCGTCTTC
CCGGTCCGCGACGCCAAGCCCAACGTCTACTGCTACCACAGCCCGGTCAAGGTGGACCCGTGGACGAAGCGGTGC
CGGCGCCGGTACGACTCGGGCGTCGCCATCCTCGAGGAGCACGTCGGCGTCAAGGTGCTGCCCTACTTCGAGGAG
GACTTTCACACCACCGTCCACGCGCAGGACGTCCAGGAGGCCTGGTCGGCCGCGCTCAACCACATGCAGTCGTCC
AGCAAGTTTGCCTTTATCTAG
Gene >Hirsu2|7197
ATGGACTGGACGCCCTCCGACGACCATGTCTCGCCGGCCTACCATCACGGGAGCCACGCCGCCAATGATGTTGAG
CTGGATGCCCTGAGTCCCGTCCAGACGGGCGGCGGCGTCGGCCGCCTGGTCGCCCACTTCGAGAACAAGGGTTTC
GCCCCCTTCGACAAGTCCTTTGCTCCGCCGCTGCCTCCGCGACCCAGCAACGGCCTTCAGATCCATCCGCAGCAT
CAACAGCATCCGCCGCATCCACAGCACCAGCAGCATCCACAGCATCAACAGCATCCACAGCATCCTCATCACCCG
CAGCATCCTCATCAACCGCAGCATCCTCACCAACCGCAGCATCATCAACCACAGCATCCTCACCAACCGCAGCAT
CAGCTTCAACAGCAACATCAACATCAACATCAGCAACAGCATCAACAACAGCATCAACAACAGCATCAAAATCAA
CATCAAAATCAGCATCAACATCAACAGCAGCAGCAGCAGCAGCAGCAGCCGGGGCAGCAGGCCGTCTCCCGGTCC
CAGTTCGACAACATGGCCTACTTCGGCCCCGGCCCCGGTCTCGCCTCCTCCTTCAACACCAACCGCATCTCCACG
CCGGTGACCGGGCCCGGCGAACCCCAGTGGGCCTCCTTCGGCGTCCAGTCGCGCGTCACGAGCCCGACGGCCGCC
AACTCGTCGCCCGTCTCCTTCGCCGGCTTCCACCAGGACGCCTCGCGCGTCGCCAGCCCGGGCAACACCCCCCTG
TCCGGCCAGTTCGCCGTCCTCGACGACTTCGTGTCTGGGAACCGCGTCCAGAGCCCCGCCGGACCCGCCGCCATG
TCCCAGATGGCCCCTTCTCCGATGGTCAGCCCCCCGGCCATCCTGTCTCCGACGACCCAGTCGAGCCCCCCCGTG
CCCGGGACGCCGGGCTTTGAAATCTGGCGGCCCCCGGGCTACGTCAGCATCAAGTCGGAGGCGGCCCCGTCGGCC
GCTTCCATCCCGCGCACCAGCGGCTACGTCAAGCCACCCCTGCCCACGACGCCGAAGCCGAATCTCAACACGTCC
GGAAATCAGTTCATCCTCGAGTTTAACCCTAGCGCCAAGGCCAAGGGAAAGGCCCCGGCCAAGCCGCCGAGGCTC
CGCGCCCCTCCGCTCATCCCACCCCCTTTCAGCCCCGAGATCAAACAGGAGCCGGTCACGCCCCAAGTATCCGAC
GCTCCACCGCCATCGACAGCTCTGCCCGTAAGTAGCAATTTTCTTTTCCACCCTCGCCCAAGCACAGCCTGCCCT
TGTCCCGCTGCTTTGCTGAAGAAAGAAAACAGTCGGTTCAGAGGCAAGCGTCCGTGTCTCTCCGCGCACACGCCG
GCCCGCGGCCCTCGCGAGAGCAGGTCCCCGCAGAGGCCTGGGAGCAGTTCAAGTCGACGATCCGAACGCTCTATC
TCGATGAGAGGAGACCGCTCAAGGAGGTCATGGCCATCATGGCCGAAAAGTACAATTTCCAGGCGACGTAAGCCG
AATTCCCCCTTTTCTCCTGCAATGGATTGATTTTTTGGGCGGGAGGGTTTGCATTGCATGTCTGACCGCGCCTCC
CACCGAACCGACAGTCCGAAAATGTACAAGACGCGCTTCTCGCAATGGGGCTTCGTCAAGAACAACACCGAGGAC
GAAGTCAAGAGGCTGCTGTCGATGAAGTTCCAGCGGGACGCCGAGGGCAAGGTGTCCGAGTTCGTCCGCAACGGG
CGGGTCGTCAACCTCGGCACCTATCTCAAGCGCAAAGGCGTGACCGAGTACGACCTGATCGACTTCGAGCTGCCG
GCCGACCTGCCGGCGCACGTCAAGTGCCGGACGCCGACGCCGCCGCCGGCGCCCGAGTACCTGCGGTCGCCGGAC
CTCCTGCGGGCGCAGGAGCTGGTGGTGGGCAACATGCGCAAGGCCTTCTTGCACTGCCGGCAGCTCGAGGTCGAG
ACGGACGCGCAGATCGGCTGGCCGGTGACAATGGTGTGGGGCGCCGGCTCGAGCGACCTGCTGATGGAGGCCAAC
TTCTACTTCGAGGCCCGGGACGCCGACCAGGGCGGGCACTTCCTGATGCGGGCCTTCAAGCAGCTCGAGGTGGAC
CTGAAGAAGCTGTCGCCGCTGGGGATCAAGGAGCTGCTGCTGGGCATGGTGCAGCGCGACCCGGGCATGATGACG
GCGCTGTGCAAGTACCTGGCGGCCTACTCGACGACGAACCTGGAGCGGTCGCACCCGCTGCGGCAGATCTTCACC
TGCCTCTACGAGGTGCAGCAGAAGCACGGGCCCGGGACGCTGTCGGACCTGCTGTGGGGCAGCATCCCGACCATC
GCGGAGGAGCTCGAGGCCATCTACAGCCGGCGGCACCCGTACGTGGCGCGGGCCTGGATCGACCTGGCCCTCTTT
TACAACCACGTGCACCCGGAGCGGCTGGCCAAGCTGGTGGCGGAGCTGCGCGGCGTCGAGCGGCAGCTGGAGCAG
CGGCACGGGGCCAACAGCGTCGACGTGCTGACGCTGCGCTACTCGATCCTGCAGCTGCTGTACGCGGCCGGGCCG
CAGTCGGAGCCGACGAAGCAGGCGGCCGTCGAGCTGTGGAACCACATGCGCGGCCTCGGCGTCGTCTTCCCGGTC
CGCGACGCCAAGCCCAACGTCTACTGCTACCACAGCCCGGTCAAGGTGGACCCGTGGACGAAGCGGTGCCGGCGC
CGGTACGACTCGGGCGTCGCCATCCTCGAGGAGCACGTCGGCGTCAAGGTGCTGCCCTACTTCGAGGAGGACTTT
CACACCACCGTCCACGCGCAGGACGTCCAGGAGGCCTGGTCGGCCGCGCTCAACCACATGCAGTCGTCCAGCAAG
TTTGCCTTTATCTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail