Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|7196
Gene name
LocationContig_404:17407..19157
Strand+
Gene length (bp)1750
Transcript length (bp)1494
Coding sequence length (bp)1494
Protein length (aa) 498

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00067 p450 Cytochrome P450 7.2E-37 95 470

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q12645|PID9_FUSSO Pisatin demethylase OS=Fusarium solani subsp. pisi GN=PDAT9 PE=3 SV=1 16 466 4.0E-51
sp|P38364|PID6_FUSSO Pisatin demethylase OS=Fusarium solani subsp. pisi GN=PDA6-1 PE=3 SV=1 16 466 6.0E-48
sp|O00061|CP67_UROFA Cytochrome P450 67 (Fragment) OS=Uromyces fabae GN=CYP67 PE=2 SV=1 25 466 1.0E-29
sp|P17549|CP53_ASPNG Benzoate 4-monooxygenase OS=Aspergillus niger GN=bphA PE=1 SV=1 27 466 7.0E-28
sp|O13317|TRI11_FUSSP Isotrichodermin C-15 hydroxylase OS=Fusarium sporotrichioides GN=TRI11 PE=3 SV=1 28 466 2.0E-26
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q12645|PID9_FUSSO Pisatin demethylase OS=Fusarium solani subsp. pisi GN=PDAT9 PE=3 SV=1 16 466 4.0E-51
sp|P38364|PID6_FUSSO Pisatin demethylase OS=Fusarium solani subsp. pisi GN=PDA6-1 PE=3 SV=1 16 466 6.0E-48
sp|O00061|CP67_UROFA Cytochrome P450 67 (Fragment) OS=Uromyces fabae GN=CYP67 PE=2 SV=1 25 466 1.0E-29
sp|P17549|CP53_ASPNG Benzoate 4-monooxygenase OS=Aspergillus niger GN=bphA PE=1 SV=1 27 466 7.0E-28
sp|O13317|TRI11_FUSSP Isotrichodermin C-15 hydroxylase OS=Fusarium sporotrichioides GN=TRI11 PE=3 SV=1 28 466 2.0E-26
sp|Q4WAW5|FTMC_ASPFU Tryprostatin B 6-hydroxylase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=ftmP450-1 PE=3 SV=2 28 466 7.0E-23
sp|B9WZX1|FTMC_ASPFM Tryprostatin B 6-hydroxylase OS=Neosartorya fumigata GN=ftmP450-1 PE=1 SV=1 28 466 7.0E-23
sp|P58046|C71AF_ARATH Cytochrome P450 71A15 OS=Arabidopsis thaliana GN=CYP71A15 PE=3 SV=1 167 466 2.0E-21
sp|A1DA60|FTMC_NEOFI Tryprostatin B 6-hydroxylase OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=ftmP450-1 PE=3 SV=1 7 466 7.0E-21
sp|Q9STL0|C71AN_ARATH Cytochrome P450 71A23 OS=Arabidopsis thaliana GN=CYP71A23 PE=2 SV=1 163 467 1.0E-20
sp|Q9T0K2|C71AK_ARATH Cytochrome P450 71A20 OS=Arabidopsis thaliana GN=CYP71A20 PE=2 SV=2 138 471 2.0E-19
sp|Q9T0K0|C71AJ_ARATH Cytochrome P450 71A19 OS=Arabidopsis thaliana GN=CYP71A19 PE=2 SV=1 144 471 5.0E-19
sp|Q9STK8|C71AP_ARATH Cytochrome P450 71A25 OS=Arabidopsis thaliana GN=CYP71A25 PE=2 SV=1 167 492 3.0E-18
sp|Q12609|STCF_EMENI Probable sterigmatocystin biosynthesis P450 monooxygenase stcF OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=stcF PE=3 SV=3 28 466 4.0E-18
sp|Q9STK7|C71AQ_ARATH Cytochrome P450 71A26 OS=Arabidopsis thaliana GN=CYP71A26 PE=3 SV=1 167 466 4.0E-18
sp|Q9ZUX1|C94C1_ARATH Cytochrome P450 94C1 OS=Arabidopsis thaliana GN=CYP94C1 PE=2 SV=1 169 470 4.0E-18
sp|Q9FIB0|C78A7_ARATH Cytochrome P450 78A7 OS=Arabidopsis thaliana GN=CYP78A7 PE=2 SV=1 170 464 5.0E-18
sp|Q12608|STCB_EMENI Probable sterigmatocystin biosynthesis P450 monooxygenase STCB OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=stcB PE=3 SV=2 28 461 6.0E-18
sp|L7X3S1|MSH_PAPSO Methyltetrahydroprotoberberine 14-monooxygenase OS=Papaver somniferum GN=CYP82N4 PE=1 SV=1 286 470 3.0E-17
sp|Q12732|AVNA_ASPPA Averantin hydroxylase OS=Aspergillus parasiticus GN=avnA PE=1 SV=2 28 466 4.0E-17
sp|Q12612|TRI4_FUSSP Trichodiene oxygenase OS=Fusarium sporotrichioides GN=TRI4 PE=3 SV=1 5 466 4.0E-17
sp|O64636|C76C1_ARATH Cytochrome P450 76C1 OS=Arabidopsis thaliana GN=CYP76C1 PE=2 SV=1 169 466 7.0E-17
sp|P48416|CP10_LYMST Cytochrome P450 10 OS=Lymnaea stagnalis GN=CYP10 PE=2 SV=1 168 462 1.0E-16
sp|O64638|C76C3_ARATH Cytochrome P450 76C3 OS=Arabidopsis thaliana GN=CYP76C3 PE=2 SV=2 169 466 2.0E-16
sp|S4UX02|CYPH1_SALMI Ferruginol synthase OS=Salvia miltiorrhiza GN=CYP76AH1 PE=1 SV=1 246 466 3.0E-16
sp|Q9FI39|THAD_ARATH Cytochrome P450 705A5 OS=Arabidopsis thaliana GN=CYP705A5 PE=2 SV=1 295 463 3.0E-16
sp|Q9STL1|C71AM_ARATH Cytochrome P450 71A22 OS=Arabidopsis thaliana GN=CYP71A22 PE=2 SV=1 180 466 4.0E-16
sp|Q8VWZ7|C76B6_CATRO Geraniol 8-hydroxylase OS=Catharanthus roseus GN=CYP76B6 PE=1 SV=1 169 466 4.0E-16
sp|Q9Y8G7|C505_FUSOX Bifunctional P-450:NADPH-P450 reductase OS=Fusarium oxysporum GN=CYP505 PE=1 SV=1 246 491 6.0E-16
sp|P48420|C78A1_MAIZE Cytochrome P450 78A1 OS=Zea mays GN=CYP78A1 PE=2 SV=1 292 466 8.0E-16
sp|Q27519|C13A7_CAEEL Putative cytochrome P450 CYP13A7 OS=Caenorhabditis elegans GN=cyp-13A7 PE=3 SV=1 75 465 3.0E-15
sp|E3W9C4|C71A1_ZINZE Alpha-humulene 10-hydroxylase OS=Zingiber zerumbet GN=CYP71BA1 PE=1 SV=1 290 470 4.0E-15
sp|O64635|C76C4_ARATH Cytochrome P450 76C4 OS=Arabidopsis thaliana GN=CYP76C4 PE=3 SV=1 290 466 4.0E-15
sp|Q9SD85|F3PH_ARATH Flavonoid 3'-monooxygenase OS=Arabidopsis thaliana GN=CYP75B1 PE=1 SV=1 256 484 6.0E-15
sp|Q27514|C13A5_CAEEL Putative cytochrome P450 CYP13A5 OS=Caenorhabditis elegans GN=cyp-13A5 PE=3 SV=1 75 465 6.0E-15
sp|B3RFJ6|86A22_PETHY Cytochrome P450 86A22 OS=Petunia hybrida GN=CYP86A22 PE=1 SV=1 166 454 6.0E-15
sp|Q9V8M2|C12B2_DROME Probable cytochrome P450 12b2, mitochondrial OS=Drosophila melanogaster GN=Cyp12b2 PE=2 SV=2 275 482 9.0E-15
sp|Q9FVS9|C96AF_ARATH Alkane hydroxylase MAH1 OS=Arabidopsis thaliana GN=CYP96A15 PE=2 SV=1 293 467 9.0E-15
sp|Q7Y1V5|C78AB_ORYSJ Cytochrome P450 78A11 OS=Oryza sativa subsp. japonica GN=CYP78A11 PE=1 SV=2 293 466 1.0E-14
sp|O49342|C71AD_ARATH Indoleacetaldoxime dehydratase OS=Arabidopsis thaliana GN=CYP71A13 PE=1 SV=1 138 466 1.0E-14
sp|D1MI46|C76BA_SWEMU Geraniol 8-hydroxylase OS=Swertia mussotii GN=CYP76B10 PE=1 SV=1 282 466 2.0E-14
sp|Q9CA60|C98A9_ARATH Cytochrome P450 98A9 OS=Arabidopsis thaliana GN=CYP98A9 PE=1 SV=1 295 484 2.0E-14
sp|O49858|C82A3_SOYBN Cytochrome P450 82A3 OS=Glycine max GN=CYP82A3 PE=2 SV=1 285 463 2.0E-14
sp|Q9VVR9|C12C1_DROME Probable cytochrome P450 12c1, mitochondrial OS=Drosophila melanogaster GN=Cyp12c1 PE=2 SV=2 289 468 2.0E-14
sp|O64637|C76C2_ARATH Cytochrome P450 76C2 OS=Arabidopsis thaliana GN=CYP76C2 PE=2 SV=1 290 466 2.0E-14
sp|Q50EK4|C75A1_PINTA Cytochrome P450 750A1 OS=Pinus taeda GN=CYP750A1 PE=2 SV=1 295 466 3.0E-14
sp|Q9VVN6|CP312_DROME Probable cytochrome P450 312a1 OS=Drosophila melanogaster GN=Cyp312a1 PE=2 SV=1 75 477 4.0E-14
sp|O23066|C86A2_ARATH Cytochrome P450 86A2 OS=Arabidopsis thaliana GN=CYP86A2 PE=1 SV=1 165 454 6.0E-14
sp|Q9STK9|C71AO_ARATH Cytochrome P450 71A24 OS=Arabidopsis thaliana GN=CYP71A24 PE=2 SV=3 180 466 8.0E-14
sp|Q9SXS3|C93C2_GLYEC 2-hydroxyisoflavanone synthase OS=Glycyrrhiza echinata GN=CYP93C2 PE=1 SV=1 270 470 8.0E-14
sp|Q00707|STCL_EMENI Versicolorin B desaturase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=stcL PE=1 SV=2 28 466 1.0E-13
sp|Q64148|CP3AA_MESAU Lithocholate 6-beta-hydroxylase OS=Mesocricetus auratus GN=CYP3A10 PE=1 SV=2 122 465 1.0E-13
sp|Q6Z5I7|C76M6_ORYSJ Oryzalexin E synthase OS=Oryza sativa subsp. japonica GN=CYP76M6 PE=1 SV=1 237 466 1.0E-13
sp|Q6YTF5|C76M5_ORYSJ Cytochrome P450 76M5 OS=Oryza sativa subsp. japonica GN=CYP76M5 PE=1 SV=1 270 466 1.0E-13
sp|O23976|C76B1_HELTU 7-ethoxycoumarin O-deethylase OS=Helianthus tuberosus GN=CYP76B1 PE=1 SV=1 237 466 1.0E-13
sp|O22203|C98A3_ARATH Cytochrome P450 98A3 OS=Arabidopsis thaliana GN=CYP98A3 PE=1 SV=1 293 462 1.0E-13
sp|Q42716|C71A8_MENPI Cytochrome P450 71A8 OS=Mentha piperita GN=CYP71A8 PE=3 SV=1 180 473 1.0E-13
sp|Q9SWR5|C93C1_SOYBN 2-hydroxyisoflavanone synthase OS=Glycine max GN=IFS2 PE=2 SV=1 295 470 2.0E-13
sp|O48922|C98A2_SOYBN Cytochrome P450 98A2 OS=Glycine max GN=CYP98A2 PE=2 SV=1 293 462 2.0E-13
sp|Q98T91|C340_ORYLA Cytochrome P450 3A40 OS=Oryzias latipes GN=cyp3a40 PE=2 SV=1 75 466 2.0E-13
sp|P93149|C93B1_GLYEC Licodione synthase OS=Glycyrrhiza echinata GN=CYP93B1 PE=1 SV=2 288 470 2.0E-13
sp|Q43068|C82A1_PEA Cytochrome P450 82A1 (Fragment) OS=Pisum sativum GN=CYP82A1 PE=2 SV=2 293 463 3.0E-13
sp|Q94FM7|C71DK_TOBAC 5-epiaristolochene 1,3-dihydroxylase OS=Nicotiana tabacum GN=CYP71D20 PE=1 SV=2 295 466 3.0E-13
sp|Q9UW95|AFLL_ASPPA Versicolorin B desaturase OS=Aspergillus parasiticus GN=verB PE=3 SV=1 28 466 4.0E-13
sp|Q27517|C13A3_CAEEL Putative cytochrome P450 CYP13A3 OS=Caenorhabditis elegans GN=cyp-13A3 PE=3 SV=1 122 468 4.0E-13
sp|Q6YV88|C71Z7_ORYSJ Ent-cassadiene C2-hydroxylase OS=Oryza sativa subsp. japonica GN=CYP71Z7 PE=1 SV=1 290 466 4.0E-13
sp|P48422|C86A1_ARATH Cytochrome P450 86A1 OS=Arabidopsis thaliana GN=CYP86A1 PE=1 SV=2 166 454 4.0E-13
sp|O65438|C71AR_ARATH Cytochrome P450 71A27 OS=Arabidopsis thaliana GN=CYP71A27 PE=3 SV=3 169 466 6.0E-13
sp|G4XV71|C93C2_GLYUR 2-hydroxyisoflavanone synthase OS=Glycyrrhiza uralensis GN=CYP93C2 PE=2 SV=2 270 470 6.0E-13
sp|Q9CAD6|C86A7_ARATH Cytochrome P450 86A7 OS=Arabidopsis thaliana GN=CYP86A7 PE=2 SV=1 167 454 6.0E-13
sp|P47195|C80A1_BERST Berbamunine synthase OS=Berberis stolonifera GN=CYP80A1 PE=1 SV=1 267 466 6.0E-13
sp|Q9VGZ0|C12E1_DROME Probable cytochrome P450 12e1, mitochondrial OS=Drosophila melanogaster GN=Cyp12e1 PE=2 SV=4 293 477 6.0E-13
sp|O48956|C98A1_SORBI Cytochrome P450 98A1 OS=Sorghum bicolor GN=CYP98A1 PE=2 SV=1 138 472 6.0E-13
sp|P43083|CP52V_CANAP Cytochrome P450 52E1 OS=Candida apicola GN=CYP52E1 PE=3 SV=1 267 462 6.0E-13
sp|O04164|C71A6_NEPRA Cytochrome P450 71A6 (Fragment) OS=Nepeta racemosa GN=CYP71A6 PE=2 SV=1 289 466 7.0E-13
sp|Q96581|C75A4_GENTR Flavonoid 3',5'-hydroxylase OS=Gentiana triflora GN=CYP75A4 PE=2 SV=1 290 473 7.0E-13
sp|I3PFJ5|C76AD_BETVU Cytochrome P450 76AD1 OS=Beta vulgaris GN=CYP76AD1 PE=2 SV=1 243 448 8.0E-13
sp|O81972|C82A2_SOYBN Cytochrome P450 82A2 OS=Glycine max GN=CYP82A2 PE=2 SV=1 286 464 9.0E-13
sp|Q9SZ46|C82C4_ARATH Cytochrome P450 82C4 OS=Arabidopsis thaliana GN=CYP82C4 PE=2 SV=1 248 467 1.0E-12
sp|Q27513|C13A4_CAEEL Putative cytochrome P450 CYP13A4 OS=Caenorhabditis elegans GN=cyp-13A4 PE=3 SV=1 62 464 1.0E-12
sp|Q9LMX7|C78A5_ARATH Cytochrome P450 78A5 OS=Arabidopsis thaliana GN=CYP78A5 PE=2 SV=1 293 464 1.0E-12
sp|P37122|C76A2_SOLME Cytochrome P450 76A2 OS=Solanum melongena GN=CYP76A2 PE=2 SV=1 250 466 1.0E-12
sp|P48421|C83A1_ARATH Cytochrome P450 83A1 OS=Arabidopsis thaliana GN=CYP83A1 PE=1 SV=2 293 472 1.0E-12
sp|O48927|C78A3_SOYBN Cytochrome P450 78A3 OS=Glycine max GN=CYP78A3 PE=2 SV=1 199 464 2.0E-12
sp|O46054|C4AE1_DROME Cytochrome P450 4ae1 OS=Drosophila melanogaster GN=Cyp4ae1 PE=2 SV=1 34 464 2.0E-12
sp|A3A871|C71Z6_ORYSJ Ent-isokaurene C2-hydroxylase OS=Oryza sativa subsp. japonica GN=CYP71Z6 PE=1 SV=1 293 480 2.0E-12
sp|H2DH18|C7A12_PANGI Cytochrome P450 CYP736A12 OS=Panax ginseng PE=2 SV=1 293 466 2.0E-12
sp|Q6YTF1|C76M8_ORYSJ Oryzalexin D synthase OS=Oryza sativa subsp. japonica GN=CYP76M8 PE=1 SV=1 237 466 2.0E-12
sp|Q9SBQ9|F3PH_PETHY Flavonoid 3'-monooxygenase OS=Petunia hybrida GN=CYP75B2 PE=2 SV=1 255 472 3.0E-12
sp|O18635|C12A2_MUSDO Cytochrome P450 CYP12A2 OS=Musca domestica GN=CYP12A2 PE=2 SV=1 289 469 3.0E-12
sp|P37120|C75A2_SOLME Flavonoid 3',5'-hydroxylase OS=Solanum melongena GN=CYP75A2 PE=2 SV=1 241 466 3.0E-12
sp|Q9LJY7|C75AK_ARATH Cytochrome P450 705A20 OS=Arabidopsis thaliana GN=CYP705A20 PE=2 SV=1 156 466 3.0E-12
sp|Q42798|C93A1_SOYBN 3,9-dihydroxypterocarpan 6A-monooxygenase OS=Glycine max GN=CYP93A1 PE=1 SV=1 290 467 3.0E-12
sp|Q29496|CP3AO_SHEEP Cytochrome P450 3A24 OS=Ovis aries GN=CYP3A24 PE=2 SV=1 75 476 3.0E-12
sp|B9DFU2|MAX1_ARATH Cytochrome P450 711A1 OS=Arabidopsis thaliana GN=CYP711A1 PE=2 SV=1 248 465 3.0E-12
sp|Q9PVE8|C330_FUNHE Cytochrome P450 3A30 OS=Fundulus heteroclitus GN=cyp3a30 PE=2 SV=2 75 466 4.0E-12
sp|Q9SP06|C80B3_PAPSO (S)-N-methylcoclaurine 3'-hydroxylase isozyme 1 (Fragment) OS=Papaver somniferum GN=CYP80B3 PE=1 SV=1 267 464 4.0E-12
sp|Q947B7|MFS_MENPI (+)-menthofuran synthase OS=Mentha piperita PE=1 SV=1 242 466 5.0E-12
sp|Q42799|C93A2_SOYBN Cytochrome P450 93A2 OS=Glycine max GN=CYP93A2 PE=2 SV=1 290 466 5.0E-12
sp|Q9FH66|C71AG_ARATH Cytochrome P450 71A16 OS=Arabidopsis thaliana GN=CYP71A16 PE=2 SV=1 180 466 5.0E-12
sp|Q54F47|C513C_DICDI Probable cytochrome P450 513C1 OS=Dictyostelium discoideum GN=cyp513C1 PE=3 SV=1 56 464 6.0E-12
sp|Q9ZNR0|C78A6_ARATH Cytochrome P450 78A6 OS=Arabidopsis thaliana GN=CYP78A6 PE=2 SV=1 293 464 6.0E-12
sp|Q9XHC6|C93E1_SOYBN Beta-amyrin 24-hydroxylase OS=Glycine max GN=CYP93E1 PE=1 SV=1 276 464 6.0E-12
sp|P58045|C71AE_ARATH Cytochrome P450 71A14 OS=Arabidopsis thaliana GN=CYP71A14 PE=2 SV=1 138 466 7.0E-12
sp|P79401|CP3AT_PIG Cytochrome P450 3A29 OS=Sus scrofa GN=CYP3A29 PE=2 SV=1 277 465 1.0E-11
sp|Q9VE00|C12A4_DROME Probable cytochrome P450 12a4, mitochondrial OS=Drosophila melanogaster GN=Cyp12a4 PE=2 SV=2 289 474 1.0E-11
sp|Q43250|C71C1_MAIZE 3-hydroxyindolin-2-one monooxygenase OS=Zea mays GN=CYP71C1 PE=1 SV=1 290 466 1.0E-11
sp|O49396|C82C3_ARATH Cytochrome P450 82C3 OS=Arabidopsis thaliana GN=CYP82C3 PE=2 SV=3 255 473 1.0E-11
sp|Q9CA61|C98A8_ARATH Cytochrome P450 98A8 OS=Arabidopsis thaliana GN=CYP98A8 PE=1 SV=1 281 464 2.0E-11
sp|P37117|C71A4_SOLME Cytochrome P450 71A4 OS=Solanum melongena GN=CYP71A4 PE=2 SV=1 277 472 2.0E-11
sp|Q6IV13|C7D95_MENSP Cytochrome P450 71D95 OS=Mentha spicata GN=CYP71D95 PE=1 SV=1 295 472 2.0E-11
sp|Q9VG40|CP134_DROME Probable cytochrome P450 313a4 OS=Drosophila melanogaster GN=Cyp313a4 PE=2 SV=4 270 481 2.0E-11
sp|Q12589|CP52K_CANMA Cytochrome P450 52A11 OS=Candida maltosa GN=CYP52A11 PE=2 SV=1 70 472 2.0E-11
sp|P11711|CP2A1_RAT Cytochrome P450 2A1 OS=Rattus norvegicus GN=Cyp2a1 PE=1 SV=2 270 466 2.0E-11
sp|Q6WKY9|C7D95_MENGR Cytochrome P450 71D95 OS=Mentha gracilis GN=CYP71D95 PE=1 SV=1 295 472 2.0E-11
sp|Q9SLP1|C78A9_ARATH Cytochrome P450 78A9 OS=Arabidopsis thaliana GN=CYP78A9 PE=2 SV=1 293 464 2.0E-11
sp|Q43255|C71C2_MAIZE indolin-2-one monooxygenase OS=Zea mays GN=CYP71C2 PE=1 SV=1 290 466 2.0E-11
sp|O65012|C78A4_PINRA Cytochrome P450 78A4 OS=Pinus radiata GN=CYP78A4 PE=2 SV=1 293 473 2.0E-11
sp|Q8AXY5|C356_FUNHE Cytochrome P450 3A56 OS=Fundulus heteroclitus GN=cyp3a56 PE=2 SV=1 75 466 3.0E-11
sp|Q9XHE8|C71DI_MENSP Cytochrome P450 71D18 OS=Mentha spicata GN=CYP71D18 PE=1 SV=1 284 466 3.0E-11
sp|Q6WKZ1|C71DI_MENGR Cytochrome P450 71D18 OS=Mentha gracilis GN=CYP71D18 PE=1 SV=1 284 466 3.0E-11
sp|F4JW83|C84A4_ARATH Cytochrome P450 84A4 OS=Arabidopsis thaliana GN=CYP84A4 PE=1 SV=1 293 466 3.0E-11
sp|Q0IIF9|CP2U1_BOVIN Cytochrome P450 2U1 OS=Bos taurus GN=CYP2U1 PE=2 SV=1 295 485 3.0E-11
sp|O49340|C71AC_ARATH Cytochrome P450 71A12 OS=Arabidopsis thaliana GN=CYP71A12 PE=2 SV=1 180 465 3.0E-11
sp|P0DKI7|STORR_PAPSO Bifunctional protein STORR OS=Papaver somniferum GN=STORR PE=1 SV=1 276 465 4.0E-11
sp|Q69X58|C76M7_ORYSJ Ent-cassadiene C11-alpha-hydroxylase 1 OS=Oryza sativa subsp. japonica GN=CYP76M7 PE=1 SV=1 246 466 4.0E-11
sp|O80823|C86A8_ARATH Cytochrome P450 86A8 OS=Arabidopsis thaliana GN=CYP86A8 PE=2 SV=1 166 454 4.0E-11
sp|O81117|C94A1_VICSA Cytochrome P450 94A1 OS=Vicia sativa GN=CYP94A1 PE=2 SV=2 169 445 5.0E-11
sp|Q64417|CP3AE_CAVPO Cytochrome P450 3A14 OS=Cavia porcellus GN=CYP3A14 PE=2 SV=2 122 471 5.0E-11
sp|O81973|C93A3_SOYBN Cytochrome P450 93A3 OS=Glycine max GN=CYP93A3 PE=2 SV=1 293 466 5.0E-11
sp|P79152|CP3AJ_CAPHE Cytochrome P450 3A19 (Fragment) OS=Capra hircus aegagrus GN=CYP3A19 PE=2 SV=1 287 464 5.0E-11
sp|I3V6B1|C80BX_PAPSO (S)-N-methylcoclaurine 3'-hydroxylase-like protein OS=Papaver somniferum GN=CYP80BX PE=2 SV=1 257 443 5.0E-11
sp|O48958|C71E1_SORBI 4-hydroxyphenylacetaldehyde oxime monooxygenase OS=Sorghum bicolor GN=CYP71E1 PE=2 SV=1 290 472 6.0E-11
sp|Q96418|C75A5_EUSER Flavonoid 3',5'-hydroxylase OS=Eustoma exaltatum subsp. russellianum GN=CYP75A5 PE=2 SV=1 290 466 6.0E-11
sp|Q6NKZ8|C14A2_ARATH Cytochrome P450 714A2 OS=Arabidopsis thaliana GN=CYP714A2 PE=2 SV=1 294 483 7.0E-11
sp|D4AY62|A1131_ARTBC Cytochrome P450 ARB_01131 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_01131 PE=3 SV=1 252 463 7.0E-11
sp|A6YIH8|C7D55_HYOMU Premnaspirodiene oxygenase OS=Hyoscyamus muticus GN=CYP71D55 PE=1 SV=1 247 466 8.0E-11
sp|Q64464|CP3AD_MOUSE Cytochrome P450 3A13 OS=Mus musculus GN=Cyp3a13 PE=1 SV=1 122 465 8.0E-11
sp|Q42602|C89A2_ARATH Cytochrome P450 89A2 OS=Arabidopsis thaliana GN=CYP89A2 PE=2 SV=2 256 485 8.0E-11
sp|P29980|CPXN_NOSS1 Probable cytochrome P450 110 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=cyp110 PE=3 SV=3 168 466 9.0E-11
sp|Q9XHE7|C71DD_MENPI Cytochrome P450 71D13 OS=Mentha piperita GN=CYP71D13 PE=1 SV=1 295 472 1.0E-10
sp|Q42600|C84A1_ARATH Cytochrome P450 84A1 OS=Arabidopsis thaliana GN=CYP84A1 PE=1 SV=1 293 472 1.0E-10
sp|Q9LSF8|C82G1_ARATH Cytochrome P450 82G1 OS=Arabidopsis thaliana GN=CYP82G1 PE=1 SV=1 294 467 1.0E-10
sp|P98188|C94A2_VICSA Cytochrome P450 94A2 OS=Vicia sativa GN=CYP94A2 PE=2 SV=1 267 455 1.0E-10
sp|Q12586|CP52I_CANMA Cytochrome P450 52A9 OS=Candida maltosa GN=CYP52A9 PE=1 SV=1 287 473 1.0E-10
sp|O09158|CP3AP_MOUSE Cytochrome P450 3A25 OS=Mus musculus GN=Cyp3a25 PE=1 SV=1 276 465 1.0E-10
sp|P48418|C75A1_PETHY Flavonoid 3',5'-hydroxylase 1 OS=Petunia hybrida GN=CYP75A1 PE=2 SV=1 262 466 1.0E-10
sp|Q12573|CP52W_CANAP Cytochrome P450 52E2 OS=Candida apicola GN=CYP52E2 PE=3 SV=1 267 462 2.0E-10
sp|Q6R7M4|C15A1_DIPPU Methyl farnesoate epoxidase OS=Diploptera punctata GN=CYP15A1 PE=1 SV=1 209 462 2.0E-10
sp|P24463|CP3AC_CANLF Cytochrome P450 3A12 OS=Canis lupus familiaris GN=CYP3A12 PE=2 SV=1 287 465 2.0E-10
sp|Q64406|CP3AF_CAVPO Cytochrome P450 3A15 OS=Cavia porcellus GN=CYP3A15 PE=2 SV=1 122 471 2.0E-10
sp|Q27589|CP4D2_DROME Cytochrome P450 4d2 OS=Drosophila melanogaster GN=Cyp4d2 PE=2 SV=2 293 470 2.0E-10
sp|O18963|CP2E1_BOVIN Cytochrome P450 2E1 OS=Bos taurus GN=CYP2E1 PE=2 SV=1 293 470 2.0E-10
sp|Q9LMM1|C86A4_ARATH Cytochrome P450 86A4 OS=Arabidopsis thaliana GN=CYP86A4 PE=1 SV=1 264 454 2.0E-10
sp|Q09653|C13AA_CAEEL Putative cytochrome P450 CYP13A10 OS=Caenorhabditis elegans GN=cyp-13A10 PE=3 SV=3 122 466 2.0E-10
sp|Q12581|CP52X_CANMA Cytochrome P450 52A5 OS=Candida maltosa GN=CYP52A5 PE=1 SV=1 284 473 2.0E-10
sp|Q6WKZ0|C7D94_MENGR Cytochrome P450 71D94 OS=Mentha gracilis GN=CYP71D94 PE=2 SV=1 295 466 2.0E-10
sp|P37123|C77A1_SOLME Cytochrome P450 77A1 (Fragment) OS=Solanum melongena GN=CYP77A1 PE=2 SV=1 295 469 2.0E-10
sp|O44220|C12B1_DROAC Cytochrome P450 12b1, mitochondrial OS=Drosophila acanthoptera GN=Cyp12b1 PE=2 SV=1 289 462 2.0E-10
sp|P37124|C77A2_SOLME Cytochrome P450 77A2 OS=Solanum melongena GN=CYP77A2 PE=2 SV=1 296 463 2.0E-10
sp|P93147|C81E1_GLYEC Isoflavone 2'-hydroxylase OS=Glycyrrhiza echinata GN=CYP81E1 PE=1 SV=2 289 467 2.0E-10
sp|Q9GQM9|CP6L1_BLAGE Cytochrome P450 6l1 OS=Blattella germanica GN=CYP6L1 PE=2 SV=1 148 461 3.0E-10
sp|Q7Z449|CP2U1_HUMAN Cytochrome P450 2U1 OS=Homo sapiens GN=CYP2U1 PE=1 SV=1 266 492 3.0E-10
sp|P82712|CCD1P_DROME Probable cytochrome P450 12d1 proximal, mitochondrial OS=Drosophila melanogaster GN=Cyp12d1-p PE=2 SV=3 217 466 3.0E-10
sp|P10615|CP52A_CANTR Cytochrome P450 52A1 OS=Candida tropicalis GN=CYP52A1 PE=1 SV=3 242 462 3.0E-10
sp|O49394|C82C2_ARATH Cytochrome P450 82C2 OS=Arabidopsis thaliana GN=CYP82C2 PE=2 SV=2 286 467 3.0E-10
sp|Q09660|CC44_CAEEL Probable cytochrome P450 CYP44 OS=Caenorhabditis elegans GN=cyp-44A1 PE=3 SV=2 169 463 3.0E-10
sp|P56655|CP238_MOUSE Cytochrome P450 2C38 OS=Mus musculus GN=Cyp2c38 PE=2 SV=2 271 470 3.0E-10
sp|P08682|CP2E1_RABIT Cytochrome P450 2E1 OS=Oryctolagus cuniculus GN=CYP2E1 PE=2 SV=2 293 470 3.0E-10
sp|O04790|C75A7_EUSER Flavonoid 3',5'-hydroxylase OS=Eustoma exaltatum subsp. russellianum GN=CYP75A7 PE=2 SV=1 262 466 4.0E-10
sp|Q64581|CP3AI_RAT Cytochrome P450 3A18 OS=Rattus norvegicus GN=Cyp3a18 PE=2 SV=1 10 465 4.0E-10
sp|Q9Y758|CP52M_DEBHN Cytochrome P450 52A13 OS=Debaryomyces hansenii GN=CYP52A13 PE=2 SV=1 70 472 4.0E-10
sp|Q64441|CP24A_MOUSE 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial OS=Mus musculus GN=Cyp24a1 PE=2 SV=1 169 464 4.0E-10
sp|P56593|CP2AC_MOUSE Cytochrome P450 2A12 OS=Mus musculus GN=Cyp2a12 PE=1 SV=2 270 466 5.0E-10
sp|P79102|CP3AS_BOVIN Cytochrome P450 3A28 OS=Bos taurus GN=CYP3A28 PE=2 SV=1 287 465 5.0E-10
sp|Q9VYQ7|CP311_DROME Probable cytochrome P450 311a1 OS=Drosophila melanogaster GN=Cyp311a1 PE=2 SV=1 235 473 5.0E-10
sp|Q7KR10|CCD1D_DROME Probable cytochrome P450 12d1 distal, mitochondrial OS=Drosophila melanogaster GN=Cyp12d1-d PE=2 SV=1 217 466 5.0E-10
sp|P79202|CP11A_SHEEP Cholesterol side-chain cleavage enzyme, mitochondrial OS=Ovis aries GN=CYP11A1 PE=1 SV=1 139 466 5.0E-10
sp|P56654|CP237_MOUSE Cytochrome P450 2C37 OS=Mus musculus GN=Cyp2c37 PE=1 SV=2 295 470 5.0E-10
sp|Q9SAB6|C71AI_ARATH Cytochrome P450 71A18 OS=Arabidopsis thaliana GN=CYP71A18 PE=2 SV=2 257 466 6.0E-10
sp|Q9V5L3|C49A1_DROME Probable cytochrome P450 49a1 OS=Drosophila melanogaster GN=Cyp49a1 PE=2 SV=3 289 473 6.0E-10
sp|P51538|CP3A9_RAT Cytochrome P450 3A9 OS=Rattus norvegicus GN=Cyp3a9 PE=2 SV=2 122 465 6.0E-10
sp|C0SJS4|C71AJ_APIGR Psoralen synthase (Fragment) OS=Apium graveolens GN=CYP71AJ2 PE=1 SV=1 295 466 6.0E-10
sp|Q9MZY0|CP2E1_CANLF Cytochrome P450 2E1 OS=Canis lupus familiaris GN=CYP2E1 PE=2 SV=1 293 470 7.0E-10
sp|F2Z9C1|P6H_ESCCA Protopine 6-monooxygenase OS=Eschscholzia californica GN=CYP82N2v2 PE=1 SV=1 286 465 7.0E-10
sp|Q12588|CP52J_CANMA Cytochrome P450 52A10 OS=Candida maltosa GN=CYP52A10 PE=2 SV=1 70 463 7.0E-10
sp|P05181|CP2E1_HUMAN Cytochrome P450 2E1 OS=Homo sapiens GN=CYP2E1 PE=1 SV=1 293 470 7.0E-10
sp|Q9CX98|CP2U1_MOUSE Cytochrome P450 2U1 OS=Mus musculus GN=Cyp2u1 PE=2 SV=2 295 466 7.0E-10
sp|P17178|CP27A_RAT Sterol 26-hydroxylase, mitochondrial OS=Rattus norvegicus GN=Cyp27a1 PE=1 SV=1 168 466 7.0E-10
sp|P05183|CP3A2_RAT Cytochrome P450 3A2 OS=Rattus norvegicus GN=Cyp3a2 PE=1 SV=2 122 465 8.0E-10
sp|Q4V8D1|CP2U1_RAT Cytochrome P450 2U1 OS=Rattus norvegicus GN=Cyp2u1 PE=1 SV=1 295 466 8.0E-10
sp|O48928|C77A3_SOYBN Cytochrome P450 77A3 OS=Glycine max GN=CYP77A3 PE=2 SV=1 295 473 8.0E-10
sp|Q9STL2|C71AL_ARATH Cytochrome P450 71A21 OS=Arabidopsis thaliana GN=CYP71A21 PE=2 SV=1 180 466 9.0E-10
sp|P24458|CP52E_CANMA Cytochrome P450 52A3-B OS=Candida maltosa GN=CYP52A3-B PE=1 SV=1 246 463 9.0E-10
sp|Q50LH4|C7193_ESCCA (S)-stylopine synthase 2 OS=Eschscholzia californica GN=CYP719A3 PE=1 SV=1 144 467 9.0E-10
sp|P93531|C71D7_SOLCH Cytochrome P450 71D7 OS=Solanum chacoense GN=CYP71D7 PE=3 SV=1 289 466 9.0E-10
sp|P30607|CP52B_CANTR Cytochrome P450 52A2 OS=Candida tropicalis GN=CYP52A2 PE=1 SV=1 283 462 1.0E-09
sp|Q07973|CP24A_HUMAN 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial OS=Homo sapiens GN=CYP24A1 PE=1 SV=2 169 465 1.0E-09
sp|Q4WAW8|FTME_ASPFU Fumitremorgin C synthase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=ftmP450-2 PE=3 SV=1 293 466 1.0E-09
sp|B9WZX4|FTME_ASPFM Fumitremorgin C synthase OS=Neosartorya fumigata GN=ftmP450-2 PE=1 SV=1 293 466 1.0E-09
sp|P56656|CP239_MOUSE Cytochrome P450 2C39 OS=Mus musculus GN=Cyp2c39 PE=1 SV=2 276 470 1.0E-09
sp|P79153|CP11A_CAPHI Cholesterol side-chain cleavage enzyme, mitochondrial OS=Capra hircus GN=CYP11A1 PE=2 SV=1 139 466 1.0E-09
sp|P08684|CP3A4_HUMAN Cytochrome P450 3A4 OS=Homo sapiens GN=CYP3A4 PE=1 SV=4 122 465 1.0E-09
sp|P16141|CP52D_CANMA Cytochrome P450 52A4 OS=Candida maltosa GN=CYP52A4 PE=1 SV=4 288 462 1.0E-09
sp|P11707|CP3A6_RABIT Cytochrome P450 3A6 OS=Oryctolagus cuniculus GN=CYP3A6 PE=2 SV=2 161 466 1.0E-09
sp|P51581|CP2E1_MESAU Cytochrome P450 2E1 OS=Mesocricetus auratus GN=CYP2E1 PE=2 SV=1 293 470 1.0E-09
sp|Q6GUQ4|CP2E1_MACMU Cytochrome P450 2E1 OS=Macaca mulatta GN=CYP2E1 PE=2 SV=1 293 470 1.0E-09
sp|Q6WNR0|C81E7_MEDTR Isoflavone 2'-hydroxylase OS=Medicago truncatula GN=CYP81E7 PE=1 SV=1 264 471 1.0E-09
sp|P00189|CP11A_BOVIN Cholesterol side-chain cleavage enzyme, mitochondrial OS=Bos taurus GN=CYP11A1 PE=1 SV=1 139 474 2.0E-09
sp|O73853|CP17A_ICTPU Steroid 17-alpha-hydroxylase/17,20 lyase OS=Ictalurus punctatus GN=cyp17a1 PE=2 SV=1 295 466 2.0E-09
sp|Q9C788|C70B1_ARATH Cytochrome P450 704B1 OS=Arabidopsis thaliana GN=CYP704B1 PE=1 SV=1 169 492 2.0E-09
sp|Q2XV99|CP11A_MACFA Cholesterol side-chain cleavage enzyme, mitochondrial OS=Macaca fascicularis GN=CYP11A1 PE=2 SV=1 139 462 2.0E-09
sp|Q9LHA1|C8D11_ARATH Cytochrome P450 81D11 OS=Arabidopsis thaliana GN=CYP81D11 PE=2 SV=1 290 467 2.0E-09
sp|Q9XHE6|C71DF_MENPI Cytochrome P450 71D15 OS=Mentha piperita GN=CYP71D15 PE=1 SV=1 295 472 2.0E-09
sp|P30608|CP52F_CANTR Cytochrome P450 52A6 OS=Candida tropicalis GN=CYP52A6 PE=2 SV=1 246 463 2.0E-09
sp|O18993|CP3AL_CALJA Cytochrome P450 3A21 OS=Callithrix jacchus GN=CYP3A21 PE=2 SV=1 75 465 2.0E-09
sp|Q9VFJ0|CA131_DROME Probable cytochrome P450 313a1 OS=Drosophila melanogaster GN=Cyp313a1 PE=3 SV=2 62 462 2.0E-09
sp|P58050|C71BD_ARATH Cytochrome P450 71B13 OS=Arabidopsis thaliana GN=CYP71B13 PE=2 SV=1 293 466 2.0E-09
sp|H2DH22|C7A10_PANGI Cytochrome P450 CYP73A100 OS=Panax ginseng PE=2 SV=1 295 463 2.0E-09
sp|Q05421|CP2E1_MOUSE Cytochrome P450 2E1 OS=Mus musculus GN=Cyp2e1 PE=1 SV=1 293 470 3.0E-09
sp|P05180|CP2H1_CHICK Cytochrome P450 2H1 OS=Gallus gallus GN=CYP2H1 PE=2 SV=1 270 467 3.0E-09
sp|Q9LIP6|C71BV_ARATH Cytochrome P450 71B34 OS=Arabidopsis thaliana GN=CYP71B34 PE=2 SV=1 131 466 3.0E-09
sp|P36423|THAS_MOUSE Thromboxane-A synthase OS=Mus musculus GN=Tbxas1 PE=1 SV=2 288 465 3.0E-09
sp|Q9LIP5|C71BW_ARATH Cytochrome P450 71B35 OS=Arabidopsis thaliana GN=CYP71B35 PE=2 SV=1 131 466 3.0E-09
sp|P37118|C71A2_SOLME Cytochrome P450 71A2 OS=Solanum melongena GN=CYP71A2 PE=2 SV=1 180 466 3.0E-09
sp|P49264|C71B1_THLAR Cytochrome P450 71B1 OS=Thlaspi arvense GN=CYP71B1 PE=2 SV=1 295 466 3.0E-09
sp|P05182|CP2E1_RAT Cytochrome P450 2E1 OS=Rattus norvegicus GN=Cyp2e1 PE=1 SV=4 293 470 3.0E-09
sp|P20815|CP3A5_HUMAN Cytochrome P450 3A5 OS=Homo sapiens GN=CYP3A5 PE=1 SV=1 75 465 4.0E-09
sp|Q96514|C71B7_ARATH Cytochrome P450 71B7 OS=Arabidopsis thaliana GN=CYP71B7 PE=1 SV=1 157 463 4.0E-09
sp|Q4G0S4|C27C1_HUMAN Cytochrome P450 27C1 OS=Homo sapiens GN=CYP27C1 PE=2 SV=2 275 478 4.0E-09
sp|P20678|CP2H2_CHICK Cytochrome P450 2H2 OS=Gallus gallus GN=CYP2H2 PE=1 SV=1 270 467 4.0E-09
sp|Q6QNI4|C71AJ_AMMMJ Psoralen synthase OS=Ammi majus GN=CYP71AJ1 PE=1 SV=1 295 466 4.0E-09
sp|P16496|CP52C_CANMA Cytochrome P450 52A3-A OS=Candida maltosa GN=CYP52A3-A PE=1 SV=3 287 463 4.0E-09
sp|Q9FG65|C81D1_ARATH Cytochrome P450 81D1 OS=Arabidopsis thaliana GN=CYP81D1 PE=2 SV=1 290 467 5.0E-09
sp|P33272|CP2BC_RAT Cytochrome P450 2B12 OS=Rattus norvegicus GN=Cyp2b12 PE=2 SV=1 293 462 5.0E-09
sp|P93530|C71D6_SOLCH Cytochrome P450 71D6 OS=Solanum chacoense GN=CYP71D6 PE=2 SV=1 264 466 5.0E-09
sp|Q9W011|C4D20_DROME Probable cytochrome P450 4d20 OS=Drosophila melanogaster GN=Cyp4d20 PE=3 SV=1 293 464 5.0E-09
sp|Q64458|CP2CT_MOUSE Cytochrome P450 2C29 OS=Mus musculus GN=Cyp2c29 PE=1 SV=2 278 471 5.0E-09
sp|P24460|CP2BB_CANLF Cytochrome P450 2B11 OS=Canis lupus familiaris GN=CYP2B11 PE=2 SV=1 280 462 5.0E-09
sp|Q9LTM3|C71BK_ARATH Cytochrome P450 71B20 OS=Arabidopsis thaliana GN=CYP71B20 PE=2 SV=1 248 466 6.0E-09
sp|Q9W130|CP9C1_DROME Cytochrome P450 9c1 OS=Drosophila melanogaster GN=Cyp9c1 PE=2 SV=1 287 458 6.0E-09
sp|Q9V419|C28A5_DROME Probable cytochrome P450 28a5 OS=Drosophila melanogaster GN=Cyp28a5 PE=2 SV=1 267 466 6.0E-09
sp|Q9Y757|CP52L_DEBHN Cytochrome P450 52A12 OS=Debaryomyces hansenii GN=CYP52A12 PE=2 SV=2 288 461 7.0E-09
sp|O81970|C71A9_SOYBN Cytochrome P450 71A9 OS=Glycine max GN=CYP71A9 PE=2 SV=1 289 466 7.0E-09
sp|P70085|CP17A_ORYLA Steroid 17-alpha-hydroxylase/17,20 lyase OS=Oryzias latipes GN=cyp17a1 PE=2 SV=1 295 462 7.0E-09
sp|Q27712|CP2L1_PANAR Cytochrome P450 2L1 OS=Panulirus argus GN=CYP2L1 PE=1 SV=1 289 475 7.0E-09
sp|O42430|CP1A1_LIMLI Cytochrome P450 1A1 OS=Limanda limanda GN=cyp1a1 PE=2 SV=1 247 464 8.0E-09
sp|Q92148|CP1A1_MICTO Cytochrome P450 1A1 OS=Microgadus tomcod GN=cyp1a1 PE=2 SV=1 156 473 9.0E-09
sp|P05179|CP2C7_RAT Cytochrome P450 2C7 OS=Rattus norvegicus GN=Cyp2c7 PE=1 SV=2 278 470 9.0E-09
sp|P04800|CP3A1_RAT Cytochrome P450 3A1 OS=Rattus norvegicus GN=Cyp3a1 PE=1 SV=1 122 465 1.0E-08
sp|O65790|C81F1_ARATH Cytochrome P450 81F1 OS=Arabidopsis thaliana GN=CYP81F1 PE=2 SV=2 248 467 1.0E-08
sp|Q9FMY1|C86B1_ARATH Cytochrome P450 86B1 OS=Arabidopsis thaliana GN=CYP86B1 PE=2 SV=1 63 416 1.0E-08
sp|Q9DBG1|CP27A_MOUSE Sterol 26-hydroxylase, mitochondrial OS=Mus musculus GN=Cyp27a1 PE=1 SV=1 168 466 1.0E-08
sp|Q9LVD2|C71BA_ARATH Cytochrome P450 71B10 OS=Arabidopsis thaliana GN=CYP71B10 PE=3 SV=1 293 466 1.0E-08
sp|Q9SRQ1|C89A9_ARATH Cytochrome P450 89A9 OS=Arabidopsis thaliana GN=CYP89A9 PE=2 SV=1 225 467 1.0E-08
sp|Q64481|CP3AG_MOUSE Cytochrome P450 3A16 OS=Mus musculus GN=Cyp3a16 PE=2 SV=2 276 465 1.0E-08
sp|P49430|THAS_RAT Thromboxane-A synthase OS=Rattus norvegicus GN=Tbxas1 PE=2 SV=1 169 465 1.0E-08
sp|Q09128|CP24A_RAT 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial OS=Rattus norvegicus GN=Cyp24a1 PE=1 SV=1 166 464 1.0E-08
sp|Q91X77|CY250_MOUSE Cytochrome P450 2C50 OS=Mus musculus GN=Cyp2c50 PE=1 SV=2 197 470 2.0E-08
sp|P15540|CP21A_PIG Steroid 21-hydroxylase OS=Sus scrofa GN=CYP21 PE=1 SV=2 293 464 2.0E-08
sp|A1DA63|FTME_NEOFI Fumitremorgin C synthase OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=ftmP450-2 PE=3 SV=1 293 466 2.0E-08
sp|P20814|CP2CD_RAT Cytochrome P450 2C13, male-specific OS=Rattus norvegicus GN=Cyp2c13 PE=1 SV=1 293 470 2.0E-08
sp|Q9LUC8|C7A13_ARATH Cytochrome P450 72A13 OS=Arabidopsis thaliana GN=CYP72A13 PE=2 SV=1 278 466 2.0E-08
sp|P30609|CP52G_CANTR Cytochrome P450 52A7 OS=Candida tropicalis GN=CYP52A7 PE=2 SV=1 291 463 2.0E-08
sp|Q92116|CP1A1_STECH Cytochrome P450 1A1 OS=Stenotomus chrysops GN=cyp1a1 PE=2 SV=1 295 473 2.0E-08
sp|P30610|CP52H_CANTR Cytochrome P450 52A8 OS=Candida tropicalis GN=CYP52A8 PE=2 SV=1 288 483 2.0E-08
sp|O65782|C83B1_ARATH Cytochrome P450 83B1 OS=Arabidopsis thaliana GN=CYP83B1 PE=1 SV=1 293 466 2.0E-08
sp|P56591|CP1A1_SHEEP Cytochrome P450 1A1 OS=Ovis aries GN=CYP1A1 PE=2 SV=1 256 467 2.0E-08
sp|Q64409|CP3AH_CAVPO Cytochrome P450 3A17 OS=Cavia porcellus GN=CYP3A17 PE=2 SV=1 287 464 3.0E-08
sp|C0SJS2|C71AJ_PASSA Psoralen synthase (Fragment) OS=Pastinaca sativa GN=CYP71AJ3 PE=1 SV=1 276 466 3.0E-08
sp|Q92039|CP1A1_CHACA Cytochrome P450 1A1 OS=Chaetodon capistratus GN=cyp1a1 PE=2 SV=1 295 465 3.0E-08
sp|Q7X7X4|C99A2_ORYSJ Cytochrome P450 99A2 OS=Oryza sativa subsp. japonica GN=CYP99A2 PE=2 SV=2 290 466 3.0E-08
sp|Q9LIP3|C71BY_ARATH Cytochrome P450 71B37 OS=Arabidopsis thaliana GN=CYP71B37 PE=3 SV=2 237 466 3.0E-08
sp|O22307|C71DB_LOTJA Cytochrome P450 71D11 (Fragment) OS=Lotus japonicus GN=CYP71D11 PE=2 SV=1 264 466 3.0E-08
sp|Q5KQT7|CP1A1_FELCA Cytochrome P450 1A1 OS=Felis catus GN=CYP1A1 PE=2 SV=1 248 466 3.0E-08
sp|P11371|CP2C4_RABIT Cytochrome P450 2C4 OS=Oryctolagus cuniculus GN=CYP2C4 PE=2 SV=1 289 470 3.0E-08
sp|O48923|C71DA_SOYBN Cytochrome P450 71D10 OS=Glycine max GN=CYP71D10 PE=2 SV=1 262 466 3.0E-08
sp|C0SJS3|ANGS_PASSA Angelicin synthase (Fragment) OS=Pastinaca sativa GN=CYP71AJ4 PE=1 SV=1 293 466 3.0E-08
sp|Q9SMP5|C94B3_ARATH Cytochrome P450 94B3 OS=Arabidopsis thaliana GN=CYP94B3 PE=2 SV=1 169 474 3.0E-08
sp|Q92045|CP11A_DASAM Cholesterol side-chain cleavage enzyme, mitochondrial (Fragment) OS=Dasyatis americana GN=CYP11A1 PE=2 SV=1 141 465 3.0E-08
sp|H1A988|C7254_GLYUR 11-oxo-beta-amyrin 30-oxidase OS=Glycyrrhiza uralensis GN=CYP72A154 PE=1 SV=1 279 466 4.0E-08
sp|P58051|C71BE_ARATH Cytochrome P450 71B14 OS=Arabidopsis thaliana GN=CYP71B14 PE=2 SV=1 293 466 4.0E-08
sp|Q9LTM0|C71BN_ARATH Cytochrome P450 71B23 OS=Arabidopsis thaliana GN=CYP71B23 PE=2 SV=1 293 466 4.0E-08
sp|Q9VG17|CP304_DROME Probable cytochrome P450 304a1 OS=Drosophila melanogaster GN=Cyp304a1 PE=2 SV=2 294 482 4.0E-08
sp|Q6XQ14|C71E7_MANES 2-methylbutanal oxime monooxygenase OS=Manihot esculenta GN=CYP71E7 PE=1 SV=1 159 466 4.0E-08
sp|P79383|CP2E1_PIG Cytochrome P450 2E1 OS=Sus scrofa GN=CYP2E1 PE=2 SV=1 293 470 4.0E-08
sp|O46515|CP11A_HORSE Cholesterol side-chain cleavage enzyme, mitochondrial OS=Equus caballus GN=CYP11A1 PE=3 SV=1 139 462 4.0E-08
sp|Q9LZ31|C77A4_ARATH Cytochrome P450 77A4 OS=Arabidopsis thaliana GN=CYP77A4 PE=2 SV=1 295 463 4.0E-08
sp|P17177|CP27A_RABIT Sterol 26-hydroxylase, mitochondrial OS=Oryctolagus cuniculus GN=CYP27A1 PE=2 SV=1 168 466 4.0E-08
sp|O15528|CP27B_HUMAN 25-hydroxyvitamin D-1 alpha hydroxylase, mitochondrial OS=Homo sapiens GN=CYP27B1 PE=1 SV=1 169 465 5.0E-08
sp|P47787|THAS_PIG Thromboxane-A synthase OS=Sus scrofa GN=TBXAS1 PE=2 SV=1 288 465 5.0E-08
sp|Q9YH64|CP1A1_PLAFE Cytochrome P450 1A1 OS=Platichthys flesus GN=cyp1a1 PE=3 SV=1 295 464 5.0E-08
sp|Q9VE01|C12A5_DROME Probable cytochrome P450 12a5, mitochondrial OS=Drosophila melanogaster GN=Cyp12a5 PE=2 SV=1 167 474 5.0E-08
sp|O55071|CP2BJ_MOUSE Cytochrome P450 2B19 OS=Mus musculus GN=Cyp2b19 PE=2 SV=1 293 462 5.0E-08
sp|Q2LA59|CP21A_LYNLY Steroid 21-hydroxylase OS=Lynx lynx GN=CYP21 PE=3 SV=1 293 475 5.0E-08
sp|Q92095|CP1A1_OPSTA Cytochrome P450 1A1 OS=Opsanus tau GN=cyp1a1 PE=2 SV=1 295 473 5.0E-08
sp|Q92104|CP11B_LITCT Cytochrome P450 11B, mitochondrial OS=Lithobates catesbeiana GN=CYP11B PE=2 SV=1 139 467 5.0E-08
sp|P33266|CP2E1_MACFA Cytochrome P450 2E1 (Fragment) OS=Macaca fascicularis GN=CYP2E1 PE=2 SV=1 293 470 5.0E-08
sp|Q9LTL2|C71BP_ARATH Cytochrome P450 71B25 OS=Arabidopsis thaliana GN=CYP71B25 PE=2 SV=1 236 466 5.0E-08
sp|P33264|CP2CR_MESAU Cytochrome P450 2C27 OS=Mesocricetus auratus GN=CYP2C27 PE=2 SV=1 295 470 5.0E-08
sp|Q2LCM1|CP21A_CANLU Steroid 21-hydroxylase OS=Canis lupus GN=CYP21 PE=3 SV=1 293 464 6.0E-08
sp|Q8WNW0|CP21A_CANLF Steroid 21-hydroxylase OS=Canis lupus familiaris GN=CYP21 PE=3 SV=1 293 464 6.0E-08
sp|Q2LA60|CP21A_FELCA Steroid 21-hydroxylase OS=Felis catus GN=CYP21 PE=3 SV=1 293 475 6.0E-08
sp|Q92100|CP1A1_PLEPL Cytochrome P450 1A1 OS=Pleuronectes platessa GN=cyp1a1 PE=2 SV=1 295 464 6.0E-08
sp|Q9DBW0|CP4V2_MOUSE Cytochrome P450 4V2 OS=Mus musculus GN=Cyp4v2 PE=1 SV=1 245 462 6.0E-08
sp|Q9FXW4|C80B2_COPJA Probable (S)-N-methylcoclaurine 3'-hydroxylase isozyme 2 OS=Coptis japonica GN=CYP80B2 PE=2 SV=1 260 466 6.0E-08
sp|P00179|CP2C5_RABIT Cytochrome P450 2C5 OS=Oryctolagus cuniculus GN=CYP2C5 PE=1 SV=2 295 470 6.0E-08
sp|Q9LTM4|C71BJ_ARATH Cytochrome P450 71B19 OS=Arabidopsis thaliana GN=CYP71B19 PE=2 SV=1 248 466 6.0E-08
sp|Q92113|CP17A_SQUAC Steroid 17-alpha-hydroxylase/17,20 lyase OS=Squalus acanthias GN=CYP17A1 PE=2 SV=1 295 451 6.0E-08
sp|Q8CIM7|CP2DQ_MOUSE Cytochrome P450 2D26 OS=Mus musculus GN=Cyp2d26 PE=1 SV=1 215 466 7.0E-08
sp|B1NF18|C719B_PAPSO Salutaridine synthase OS=Papaver somniferum GN=CYP719B1 PE=1 SV=1 290 467 7.0E-08
sp|P58048|C71B8_ARATH Cytochrome P450 71B8 OS=Arabidopsis thaliana GN=CYP71B8 PE=3 SV=1 169 466 7.0E-08
sp|Q9LIP4|C71BX_ARATH Cytochrome P450 71B36 OS=Arabidopsis thaliana GN=CYP71B36 PE=3 SV=1 255 466 7.0E-08
sp|P85191|CP450_HELAN Cytochrome P450 (Fragment) OS=Helianthus annuus PE=1 SV=1 341 467 8.0E-08
sp|Q9QUJ1|CP2DS_MESAU Cytochrome P450 2D28 OS=Mesocricetus auratus GN=CYP2D28A PE=2 SV=1 165 466 9.0E-08
sp|B9G934|C14C3_ORYSJ Cytochrome P450 714C3 OS=Oryza sativa subsp. japonica GN=CYP714C3 PE=3 SV=2 294 464 9.0E-08
sp|Q06367|CP1A1_CAVPO Cytochrome P450 1A1 OS=Cavia porcellus GN=CYP1A1 PE=1 SV=1 290 464 9.0E-08
sp|P33263|CP2CQ_MESAU Cytochrome P450 2C26 OS=Mesocricetus auratus GN=CYP2C26 PE=2 SV=1 295 470 9.0E-08
sp|Q9QYG5|CP2DK_MESAU Cytochrome P450 2D20 OS=Mesocricetus auratus GN=CYP2D20 PE=2 SV=1 215 466 1.0E-07
sp|P51590|CP2J3_RAT Cytochrome P450 2J3 OS=Rattus norvegicus GN=Cyp2j3 PE=2 SV=1 248 465 1.0E-07
sp|P0DKI2|C76AN_BETVU Inactive cytochrome P450 76AD1 OS=Beta vulgaris GN=CYP76AD1 PE=3 SV=1 237 413 1.0E-07
sp|Q9QYG6|CP2DR_MESAU Cytochrome P450 2D27 OS=Mesocricetus auratus GN=CYP2D27 PE=1 SV=1 215 466 1.0E-07
sp|B9GBJ9|C14C1_ORYSJ Cytochrome P450 714C1 OS=Oryza sativa subsp. japonica GN=CYP714C1 PE=2 SV=1 294 464 1.0E-07
sp|Q9VS79|CP4D8_DROME Cytochrome P450 4d8 OS=Drosophila melanogaster GN=Cyp4d8 PE=2 SV=2 293 464 1.0E-07
sp|P10634|CP2DQ_RAT Cytochrome P450 2D26 OS=Rattus norvegicus GN=Cyp2d26 PE=1 SV=2 215 467 1.0E-07
sp|Q04468|TCMO_HELTU Trans-cinnamate 4-monooxygenase OS=Helianthus tuberosus GN=CYP73A1 PE=1 SV=1 124 464 1.0E-07
sp|P24465|C71A1_PERAE Cytochrome P450 71A1 OS=Persea americana GN=CYP71A1 PE=1 SV=2 289 466 1.0E-07
sp|O81974|C71D8_SOYBN Cytochrome P450 71D8 OS=Glycine max GN=CYP71D8 PE=2 SV=1 295 472 1.0E-07
sp|Q9VMT5|C28D1_DROME Probable cytochrome P450 28d1 OS=Drosophila melanogaster GN=Cyp28d1 PE=2 SV=1 256 481 1.0E-07
sp|Q92109|CP1A3_ONCMY Cytochrome P450 1A3 OS=Oncorhynchus mykiss GN=cyp1a3 PE=2 SV=2 256 473 2.0E-07
sp|Q27516|C13A8_CAEEL Putative cytochrome P450 CYP13A8 OS=Caenorhabditis elegans GN=cyp-13A8 PE=3 SV=2 273 465 2.0E-07
sp|P10610|CP2G1_RAT Cytochrome P450 2G1 OS=Rattus norvegicus GN=Cyp2g1 PE=2 SV=1 293 469 2.0E-07
sp|Q9LUC9|C7A11_ARATH Cytochrome P450 72A11 OS=Arabidopsis thaliana GN=CYP72A11 PE=2 SV=1 278 466 2.0E-07
sp|B8NHY4|ORDA_ASPFN O-methylsterigmatocystin oxidoreductase OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=ordA PE=2 SV=1 293 447 2.0E-07
sp|Q5VDD6|ORDA_ASPFL O-methylsterigmatocystin oxidoreductase OS=Aspergillus flavus GN=ordA PE=3 SV=2 293 447 2.0E-07
sp|O08394|CYPD_BACSU Bifunctional cytochrome P450/NADPH--P450 reductase 1 OS=Bacillus subtilis (strain 168) GN=cypD PE=1 SV=1 227 462 2.0E-07
sp|Q9VXY0|CP4S3_DROME Probable cytochrome P450 4s3 OS=Drosophila melanogaster GN=Cyp4s3 PE=3 SV=1 1 464 2.0E-07
sp|P00191|CP21A_BOVIN Steroid 21-hydroxylase OS=Bos taurus GN=CYP21 PE=1 SV=2 138 464 2.0E-07
sp|O35293|CP2F2_RAT Cytochrome P450 2F2 OS=Rattus norvegicus GN=Cyp2f2 PE=2 SV=1 265 470 2.0E-07
sp|O65788|C71B2_ARATH Cytochrome P450 71B2 OS=Arabidopsis thaliana GN=CYP71B2 PE=2 SV=2 248 466 2.0E-07
sp|P24557|THAS_HUMAN Thromboxane-A synthase OS=Homo sapiens GN=TBXAS1 PE=1 SV=3 288 465 3.0E-07
sp|Q43257|C71C4_MAIZE indole-2-monooxygenase OS=Zea mays GN=CYP71C4 PE=1 SV=1 290 466 3.0E-07
sp|P20813|CP2B6_HUMAN Cytochrome P450 2B6 OS=Homo sapiens GN=CYP2B6 PE=1 SV=1 274 462 3.0E-07
sp|P30611|CP52N_CANTR Cytochrome P450 52B1 OS=Candida tropicalis GN=CYP52B1 PE=2 SV=1 256 463 3.0E-07
sp|Q9VGB5|CP135_DROME Probable cytochrome P450 313a5 OS=Drosophila melanogaster GN=Cyp313a5 PE=1 SV=2 293 462 3.0E-07
sp|Q08078|CP2CP_MESAU Cytochrome P450 2C25 OS=Mesocricetus auratus GN=CYP2C25 PE=2 SV=1 295 470 3.0E-07
sp|O13345|ORDA_ASPPA O-methylsterigmatocystin oxidoreductase OS=Aspergillus parasiticus GN=ordA PE=1 SV=1 293 472 4.0E-07
sp|E1B2Z9|C7AV8_CICIN Cytochrome P450 71AV8 OS=Cichorium intybus GN=CYP71AV8 PE=2 SV=1 214 466 4.0E-07
sp|P97720|C11B1_MESAU Cytochrome P450 11B1, mitochondrial OS=Mesocricetus auratus GN=CYP11B1 PE=2 SV=1 139 468 4.0E-07
sp|O48921|C97B2_SOYBN Cytochrome P450 97B2, chloroplastic OS=Glycine max GN=CYP97B2 PE=2 SV=1 280 466 4.0E-07
sp|Q2PG45|THAS_MACFA Thromboxane-A synthase OS=Macaca fascicularis GN=TBXAS1 PE=2 SV=2 288 465 4.0E-07
sp|D5JBX1|GAO_BARSP Germacrene A oxidase OS=Barnadesia spinosa PE=1 SV=1 289 466 4.0E-07
sp|P37121|C76A1_SOLME Cytochrome P450 76A1 (Fragment) OS=Solanum melongena GN=CYP76A1 PE=2 SV=1 147 472 4.0E-07
sp|P24456|CP2DA_MOUSE Cytochrome P450 2D10 OS=Mus musculus GN=Cyp2d10 PE=1 SV=2 215 466 4.0E-07
sp|Q43033|TCMO_PETCR Trans-cinnamate 4-monooxygenase OS=Petroselinum crispum GN=CYP73A10 PE=2 SV=1 295 464 5.0E-07
sp|P08686|CP21A_HUMAN Steroid 21-hydroxylase OS=Homo sapiens GN=CYP21A2 PE=1 SV=1 293 464 5.0E-07
sp|Q9WVK8|CP46A_MOUSE Cholesterol 24-hydroxylase OS=Mus musculus GN=Cyp46a1 PE=1 SV=1 27 471 5.0E-07
sp|H2DH24|C7D47_PANGI Cytochrome P450 CYP82D47 OS=Panax ginseng PE=2 SV=1 286 462 6.0E-07
sp|Q940V4|C85A2_ARATH Cytochrome P450 85A2 OS=Arabidopsis thaliana GN=CYP85A2 PE=2 SV=1 255 455 6.0E-07
sp|P15123|CP2CG_RABIT Cytochrome P450 2C16 OS=Oryctolagus cuniculus GN=CYP2C16 PE=2 SV=1 295 470 6.0E-07
sp|Q43240|TCMO_ZINVI Trans-cinnamate 4-monooxygenase OS=Zinnia violacea GN=CYP73A12 PE=2 SV=1 295 464 7.0E-07
sp|Q9VLZ7|C4D21_DROME Probable cytochrome P450 4d21 OS=Drosophila melanogaster GN=Cyp4d21 PE=3 SV=1 293 464 7.0E-07
sp|Q9AR74|TCMO_RUTGR Trans-cinnamate 4-monooxygenase OS=Ruta graveolens GN=CYP73A2 PE=2 SV=1 295 482 7.0E-07
sp|Q964R0|CP6K1_BLAGE Cytochrome P450 6k1 OS=Blattella germanica GN=CYP6K1 PE=2 SV=1 287 463 8.0E-07
sp|P12394|CP17A_CHICK Steroid 17-alpha-hydroxylase/17,20 lyase OS=Gallus gallus GN=CYP17A1 PE=2 SV=1 295 465 8.0E-07
sp|P11712|CP2C9_HUMAN Cytochrome P450 2C9 OS=Homo sapiens GN=CYP2C9 PE=1 SV=3 295 471 8.0E-07
sp|Q9LUC5|C7A15_ARATH Cytochrome P450 72A15 OS=Arabidopsis thaliana GN=CYP72A15 PE=2 SV=1 278 485 8.0E-07
sp|Q8WNE1|CP2F5_GORGO Cytochrome P450 2F5 OS=Gorilla gorilla gorilla GN=CYP2F5 PE=3 SV=2 265 465 8.0E-07
sp|P10632|CP2C8_HUMAN Cytochrome P450 2C8 OS=Homo sapiens GN=CYP2C8 PE=1 SV=2 295 467 9.0E-07
sp|Q54LT7|C519E_DICDI Probable cytochrome P450 519E1 OS=Dictyostelium discoideum GN=cyp519E1 PE=3 SV=1 293 464 1.0E-06
sp|Q5KQT6|CP1A2_FELCA Cytochrome P450 1A2 OS=Felis catus GN=CYP1A2 PE=2 SV=1 248 466 1.0E-06
sp|Q9VMT6|C28D2_DROME Probable cytochrome P450 28d2 OS=Drosophila melanogaster GN=Cyp28d2 PE=3 SV=1 257 466 1.0E-06
sp|P05178|CP2C6_RAT Cytochrome P450 2C6 OS=Rattus norvegicus GN=Cyp2c6 PE=2 SV=2 295 467 1.0E-06
sp|P33261|CP2CJ_HUMAN Cytochrome P450 2C19 OS=Homo sapiens GN=CYP2C19 PE=1 SV=3 295 470 1.0E-06
sp|P12938|CP2D3_RAT Cytochrome P450 2D3 OS=Rattus norvegicus GN=Cyp2d3 PE=2 SV=2 155 466 1.0E-06
sp|Q05047|C72A1_CATRO Secologanin synthase OS=Catharanthus roseus GN=CYP72A1 PE=2 SV=1 279 466 1.0E-06
sp|Q29552|C11B1_PIG Cytochrome P450 11B1, mitochondrial OS=Sus scrofa GN=CYP11B1 PE=2 SV=1 291 468 2.0E-06
sp|Q86A22|C515A_DICDI Probable cytochrome P450 515A1 OS=Dictyostelium discoideum GN=cyp515A1 PE=3 SV=1 293 465 2.0E-06
sp|P13108|CP2D4_RAT Cytochrome P450 2D4 OS=Rattus norvegicus GN=Cyp2d4 PE=2 SV=2 295 466 2.0E-06
sp|P98183|C71DC_CATRO Tabersonine 16-hydroxylase (Fragment) OS=Catharanthus roseus GN=CYP71D12 PE=1 SV=1 169 465 2.0E-06
sp|P15393|C11B1_RAT Cytochrome P450 11B1, mitochondrial OS=Rattus norvegicus GN=Cyp11b1 PE=1 SV=1 291 468 2.0E-06
sp|O24312|TCMO_POPTM Trans-cinnamate 4-monooxygenase OS=Populus tremuloides GN=CYP73A13 PE=2 SV=1 295 464 3.0E-06
sp|Q2XNC8|CP2D6_PANTR Cytochrome P450 2D6 OS=Pan troglodytes GN=CYP2D6 PE=3 SV=1 295 466 3.0E-06
sp|D5JBX0|GAO_HELAN Germacrene A oxidase OS=Helianthus annuus PE=1 SV=1 290 466 3.0E-06
sp|Q64680|CP2DI_RAT Cytochrome P450 2D18 OS=Rattus norvegicus GN=Cyp2d18 PE=2 SV=1 295 466 3.0E-06
sp|Q42797|TCMO_SOYBN Trans-cinnamate 4-monooxygenase OS=Glycine max GN=CYP73A11 PE=2 SV=1 295 464 4.0E-06
sp|P51663|C11B1_SHEEP Cytochrome P450 11B1, mitochondrial OS=Ovis aries GN=CYP11B1 PE=2 SV=2 139 468 4.0E-06
sp|Q9LTM6|C71BH_ARATH Cytochrome P450 71B17 OS=Arabidopsis thaliana GN=CYP71B17 PE=3 SV=1 248 466 5.0E-06
sp|Q29488|CP2DH_MACFA Cytochrome P450 2D17 OS=Macaca fascicularis GN=CYP2D17 PE=2 SV=1 159 466 5.0E-06
sp|Q91W64|CP270_MOUSE Cytochrome P450 2C70 OS=Mus musculus GN=Cyp2c70 PE=1 SV=2 295 470 6.0E-06
sp|Q9NGX9|CP302_DROME Cytochrome P450 302a1, mitochondrial OS=Drosophila melanogaster GN=dib PE=2 SV=2 255 447 6.0E-06
sp|P10635|CP2D6_HUMAN Cytochrome P450 2D6 OS=Homo sapiens GN=CYP2D6 PE=1 SV=2 295 466 7.0E-06
sp|Q43054|TCMO_POPKI Trans-cinnamate 4-monooxygenase OS=Populus kitakamiensis GN=CYP73A16 PE=2 SV=1 295 463 7.0E-06
sp|Q01361|CP2DE_BOVIN Cytochrome P450 2D14 OS=Bos taurus GN=CYP2D14 PE=2 SV=2 295 466 7.0E-06
sp|P15539|C11B2_MOUSE Cytochrome P450 11B2, mitochondrial OS=Mus musculus GN=Cyp11b2 PE=2 SV=3 291 468 7.0E-06
sp|Q9Y6A2|CP46A_HUMAN Cholesterol 24-hydroxylase OS=Homo sapiens GN=CYP46A1 PE=1 SV=1 62 471 8.0E-06
sp|Q96423|TCMO_GLYEC Trans-cinnamate 4-monooxygenase OS=Glycyrrhiza echinata GN=CYP73A14 PE=2 SV=1 295 464 8.0E-06
sp|Q2XNC9|CP2D6_PANPA Cytochrome P450 2D6 OS=Pan paniscus GN=CYP2D6 PE=3 SV=1 295 466 8.0E-06
sp|Q6WNQ9|C81E9_MEDTR Isoflavone 3'-hydroxylase (Fragment) OS=Medicago truncatula GN=CYP81E9 PE=1 SV=1 293 447 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016705 oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen Yes
GO:0020037 heme binding Yes
GO:0005506 iron ion binding Yes
GO:0055114 oxidation-reduction process Yes
GO:0046872 metal ion binding No
GO:0016491 oxidoreductase activity No
GO:0046906 tetrapyrrole binding No
GO:0043169 cation binding No
GO:0008152 metabolic process No
GO:1901363 heterocyclic compound binding No
GO:0048037 cofactor binding No
GO:0008150 biological_process No
GO:0043167 ion binding No
GO:0097159 organic cyclic compound binding No
GO:0003674 molecular_function No
GO:0003824 catalytic activity No
GO:0046914 transition metal ion binding No
GO:0005488 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 22 0.5

Transmembrane Domains

Domain # Start End Length
1 7 25 18

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|7196
MASQAAACLALLVAAWYAVSAVVAWRRLRTVSGPALARFSYLWIAGAALSGRSSDRYRALDRRHGSLVRVGPNEL
LTSDPAVMRAMSAARSAYRRSSWYRAIRLDRSVDNMASTLDTAAHDRLRARAAPGYSGRDNPAFEPGVDAQVAAL
VRLVERRYLTDAAAFRPPDLARAAQLFALDVITRLLYGREPGCLAADADLDGLIGALDRLVPYLEILGAVPVLAR
LVQSPLLLRAVGPRAGDASGIGKLMGLSHDIIAERYRPGAEERTDMIASFARNGMEQRQCESEALLQIFAGSETT
ATAIRVVMLHVLAAPSVYARLGREIAARAAAGRISSPITNAEAAGFPYLQAVVQEGLRMQPPSPALVMKQVPPGG
DVLHGHFVPGGTRVGHNLGPLVRDKAVFGPDAALFRPERWLAGDAEARLRMRRQLDLVWGHGRWTCPGRDIALME
LNKVLVELFRNFDFQLVYPQRPLFSRQHNTIIQRHLWVSVSRAASRE*
Coding >Hirsu2|7196
ATGGCGTCGCAAGCAGCGGCCTGTCTCGCGCTCTTGGTCGCCGCCTGGTACGCCGTCTCGGCCGTGGTCGCGTGG
CGCCGGCTGCGGACCGTGTCCGGGCCGGCGCTCGCCCGCTTCTCCTACCTGTGGATCGCCGGCGCCGCCCTCTCC
GGCCGGTCCTCCGACCGCTACCGCGCGCTGGACCGGCGGCACGGCAGCCTGGTGCGCGTCGGCCCCAACGAGCTG
CTGACGTCGGACCCGGCCGTGATGCGCGCCATGTCGGCCGCCCGGTCGGCCTACCGCCGCTCGTCGTGGTACCGC
GCCATCCGGCTGGACCGGTCCGTCGACAACATGGCCAGCACGCTCGACACGGCCGCCCACGACCGCCTCCGCGCC
CGGGCCGCCCCCGGCTACAGCGGCCGCGACAACCCGGCCTTCGAGCCCGGCGTCGACGCCCAGGTCGCCGCCCTG
GTCCGCCTCGTCGAGCGCCGCTACCTGACGGACGCGGCCGCCTTCCGGCCGCCCGACCTGGCCCGCGCCGCCCAG
CTCTTCGCCCTCGACGTCATCACCCGCCTGCTGTACGGCCGCGAGCCCGGATGCCTGGCCGCCGACGCGGACCTC
GACGGGCTCATCGGCGCCCTCGACCGCCTCGTGCCCTACCTCGAGATCCTCGGCGCCGTCCCGGTCCTCGCCCGC
CTCGTCCAGTCCCCGCTGCTGCTCAGGGCCGTCGGGCCGAGGGCCGGCGACGCGAGCGGCATCGGGAAACTCATG
GGCCTGTCACACGATATCATCGCGGAGCGGTATAGGCCGGGCGCGGAGGAGAGGACGGACATGATCGCTTCCTTC
GCCCGCAACGGCATGGAGCAGCGGCAGTGCGAGAGCGAGGCCTTGCTGCAGATCTTCGCCGGCTCCGAGACGACG
GCGACGGCGATCCGCGTCGTCATGCTGCACGTCCTCGCCGCGCCCTCCGTCTACGCCCGGCTCGGGCGCGAGATC
GCGGCTCGGGCCGCCGCCGGGCGCATCTCGAGCCCCATCACCAACGCCGAGGCCGCCGGCTTCCCCTACCTCCAG
GCCGTCGTCCAGGAGGGCCTCCGGATGCAGCCGCCGTCGCCGGCGCTGGTGATGAAACAGGTGCCGCCCGGCGGC
GACGTGCTGCACGGGCACTTCGTCCCGGGCGGCACGCGCGTCGGCCACAACCTGGGCCCGCTCGTGCGCGACAAG
GCCGTCTTCGGGCCCGACGCCGCCCTGTTCCGCCCCGAGCGCTGGCTCGCCGGCGATGCCGAGGCGCGGCTGCGG
ATGCGCCGCCAGCTCGACCTCGTCTGGGGCCACGGCCGCTGGACCTGTCCCGGCCGGGACATTGCGCTGATGGAG
CTGAACAAGGTCCTGGTCGAGCTGTTCCGCAACTTCGACTTCCAGCTCGTCTACCCGCAGCGGCCGCTGTTCAGC
AGGCAGCACAACACCATCATCCAGCGCCATCTCTGGGTCAGCGTCTCGCGCGCCGCCTCGCGCGAATAA
Transcript >Hirsu2|7196
ATGGCGTCGCAAGCAGCGGCCTGTCTCGCGCTCTTGGTCGCCGCCTGGTACGCCGTCTCGGCCGTGGTCGCGTGG
CGCCGGCTGCGGACCGTGTCCGGGCCGGCGCTCGCCCGCTTCTCCTACCTGTGGATCGCCGGCGCCGCCCTCTCC
GGCCGGTCCTCCGACCGCTACCGCGCGCTGGACCGGCGGCACGGCAGCCTGGTGCGCGTCGGCCCCAACGAGCTG
CTGACGTCGGACCCGGCCGTGATGCGCGCCATGTCGGCCGCCCGGTCGGCCTACCGCCGCTCGTCGTGGTACCGC
GCCATCCGGCTGGACCGGTCCGTCGACAACATGGCCAGCACGCTCGACACGGCCGCCCACGACCGCCTCCGCGCC
CGGGCCGCCCCCGGCTACAGCGGCCGCGACAACCCGGCCTTCGAGCCCGGCGTCGACGCCCAGGTCGCCGCCCTG
GTCCGCCTCGTCGAGCGCCGCTACCTGACGGACGCGGCCGCCTTCCGGCCGCCCGACCTGGCCCGCGCCGCCCAG
CTCTTCGCCCTCGACGTCATCACCCGCCTGCTGTACGGCCGCGAGCCCGGATGCCTGGCCGCCGACGCGGACCTC
GACGGGCTCATCGGCGCCCTCGACCGCCTCGTGCCCTACCTCGAGATCCTCGGCGCCGTCCCGGTCCTCGCCCGC
CTCGTCCAGTCCCCGCTGCTGCTCAGGGCCGTCGGGCCGAGGGCCGGCGACGCGAGCGGCATCGGGAAACTCATG
GGCCTGTCACACGATATCATCGCGGAGCGGTATAGGCCGGGCGCGGAGGAGAGGACGGACATGATCGCTTCCTTC
GCCCGCAACGGCATGGAGCAGCGGCAGTGCGAGAGCGAGGCCTTGCTGCAGATCTTCGCCGGCTCCGAGACGACG
GCGACGGCGATCCGCGTCGTCATGCTGCACGTCCTCGCCGCGCCCTCCGTCTACGCCCGGCTCGGGCGCGAGATC
GCGGCTCGGGCCGCCGCCGGGCGCATCTCGAGCCCCATCACCAACGCCGAGGCCGCCGGCTTCCCCTACCTCCAG
GCCGTCGTCCAGGAGGGCCTCCGGATGCAGCCGCCGTCGCCGGCGCTGGTGATGAAACAGGTGCCGCCCGGCGGC
GACGTGCTGCACGGGCACTTCGTCCCGGGCGGCACGCGCGTCGGCCACAACCTGGGCCCGCTCGTGCGCGACAAG
GCCGTCTTCGGGCCCGACGCCGCCCTGTTCCGCCCCGAGCGCTGGCTCGCCGGCGATGCCGAGGCGCGGCTGCGG
ATGCGCCGCCAGCTCGACCTCGTCTGGGGCCACGGCCGCTGGACCTGTCCCGGCCGGGACATTGCGCTGATGGAG
CTGAACAAGGTCCTGGTCGAGCTGTTCCGCAACTTCGACTTCCAGCTCGTCTACCCGCAGCGGCCGCTGTTCAGC
AGGCAGCACAACACCATCATCCAGCGCCATCTCTGGGTCAGCGTCTCGCGCGCCGCCTCGCGCGAATAA
Gene >Hirsu2|7196
ATGGCGTCGCAAGCAGCGGCCTGTCTCGCGCTCTTGGTCGCCGCCTGGTACGCCGTCTCGGCCGTGGTCGCGTGG
CGCCGGCTGCGGACCGTGTCCGGGCCGGCGCTCGCCCGCTTCTCCTACCTGTGGATCGCCGGCGCCGCCCTCTCC
GGCCGGTCCTCCGACCGCTACCGCGCGCTGGACCGGCGGCACGGCAGCCTGGTGCGCGTCGGCCCCAACGAGCTG
CTGACGTCGGACCCGGCCGTGATGCGCGCCATGTCGGCCGCCCGGTCGGCCTACCGCCGCTCGTCGTGGTACCGC
GCCATCCGGCTGGACCGGTCCGTCGACAACATGGCCAGCACGCTCGACACGGCCGCCCACGACCGCCTCCGCGCC
CGGGCCGCCCCCGGCTACAGCGGCCGCGACAACCCGGCCTTCGAGCCCGGCGTCGACGCCCAGGTCGCCGCCCTG
GTCCGCCTCGTCGAGCGCCGCTACCTGACGGACGCGGCCGCCTTCCGGCCGCCCGACCTGGCCCGCGCCGCCCAG
CTCTTCGCCCTCGACGTCATCACCCGCCTGCTGTACGGCCGCGAGCCCGGATGCCTGGCCGCCGACGCGGACCTC
GACGGGCTCATCGGCGCCCTCGACCGCCTCGTGCCCTACCTCGAGATCCTCGGCGCCGTCCCGGTCCTCGCCCGC
CTCGTCCAGTCCCCGCTGCTGCTCAGGGCCGTCGGGCCGAGGGCCGGCGACGCGAGCGGCATCGGGAAACTCATG
GGGTGAGAGGCGGTGCTCGAGAAACGCGGGCGGCGCGCGCTGACGCCGTCCGCAGCCTGTCACACGATATCATCG
CGGAGCGGTATAGGCCGGGCGCGGAGGAGAGGACGGACATGATCGTTTGTGCTCCCGCTTCCCTTCCTGCCCCCC
CCCCCCCTTGTGCCGTCTTCTAAGGCCTCCAGGCTTCCTTCGCCCGCAACGGCATGGAGCAGCGGCAGTGCGAGA
GCGAGGCCTTGCTGCAGATCTTCGCCGGCTCCGAGACGACGGCGACGGCGATCCGCGTCGTCATGCTGCACGTCC
TCGCCGCGCCCTCCGTCTACGCCCGGCTCGGGCGCGAGATCGCGGCTCGGGCCGCCGCCGGGCGCATCTCGAGCC
CCATCACCAACGCCGAGGCCGCCGGCTTCCCCTACCTCCAGGTGCGTCTCCTGTCTGCGCCGAGCTCGCGCCCTT
GCCGGCCGCTGACCGAAGACGGCTCCGTCCGCCTCTCTCCCGCCCTCGTCAGGCCGTCGTCCAGGAGGGCCTCCG
GATGCAGCCGCCGTCGCCGGCGCTGGTGATGAAACAGGTGCCGCCCGGCGGCGACGTGCTGCACGGGCACTTCGT
CCCGGGCGGCACGCGCGTCGGCCACAACCTGGGCCCGCTCGTGCGCGACAAGGCCGTCTTCGGGCCCGACGCCGC
CCTGTTCCGCCCCGAGCGCTGGCTCGCCGGCGATGCCGAGGCGCGGCTGCGGATGCGCCGCCAGCTCGACCTCGT
CTGGGGCCACGGCCGCTGGACCTGTCCCGGCCGGGACATTGCGCTGATGGAGCTGAACAAGGTCCTGGTCGAGGT
TCGTGGCCGGAACCCCCTTTCTCGCTCCTGGGCCGAGACTGACGGCCGGCAGCTGTTCCGCAACTTCGACTTCCA
GCTCGTCTACCCGCAGCGGCCGCTGTTCAGCAGGCAGCACAACACCATCATCCAGCGCCATCTCTGGGTCAGCGT
CTCGCGCGCCGCCTCGCGCGAATAA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail