Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|7190
Gene name
LocationContig_404:7984..8770
Strand-
Gene length (bp)786
Transcript length (bp)786
Coding sequence length (bp)786
Protein length (aa) 262

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07962 Swi3 Replication Fork Protection Component Swi3 6.0E-19 73 132

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|A4RCW0|CSM3_MAGO7 Chromosome segregation in meiosis protein 3 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=CSM3 PE=3 SV=1 8 226 1.0E-37
sp|Q7SHE8|CSM3_NEUCR Chromosome segregation in meiosis protein 3 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=csm-3 PE=3 SV=1 21 222 8.0E-35
sp|Q0CU66|CSM3_ASPTN Chromosome segregation in meiosis protein 3 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=csm3 PE=3 SV=2 15 223 3.0E-28
sp|Q2H3R6|CSM3_CHAGB Chromosome segregation in meiosis protein 3 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=CSM3 PE=3 SV=1 29 196 8.0E-27
sp|A1D9E6|CSM3_NEOFI Chromosome segregation in meiosis protein 3 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=csm3 PE=3 SV=1 11 145 6.0E-26
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|A4RCW0|CSM3_MAGO7 Chromosome segregation in meiosis protein 3 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=CSM3 PE=3 SV=1 8 226 1.0E-37
sp|Q7SHE8|CSM3_NEUCR Chromosome segregation in meiosis protein 3 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=csm-3 PE=3 SV=1 21 222 8.0E-35
sp|Q0CU66|CSM3_ASPTN Chromosome segregation in meiosis protein 3 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=csm3 PE=3 SV=2 15 223 3.0E-28
sp|Q2H3R6|CSM3_CHAGB Chromosome segregation in meiosis protein 3 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=CSM3 PE=3 SV=1 29 196 8.0E-27
sp|A1D9E6|CSM3_NEOFI Chromosome segregation in meiosis protein 3 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=csm3 PE=3 SV=1 11 145 6.0E-26
sp|A1C8Y9|CSM3_ASPCL Chromosome segregation in meiosis protein 3 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=csm3 PE=3 SV=1 11 135 4.0E-25
sp|A4DA84|CSM3_ASPFU Chromosome segregation in meiosis protein 3 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=csm3 PE=3 SV=1 56 222 3.0E-24
sp|Q0UJ25|CSM3_PHANO Chromosome segregation in meiosis protein 3 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=CSM3 PE=3 SV=1 6 174 5.0E-23
sp|Q1DME8|CSM3_COCIM Chromosome segregation in meiosis protein 3 OS=Coccidioides immitis (strain RS) GN=CSM3 PE=3 SV=2 15 231 1.0E-22
sp|Q6C656|CSM3_YARLI Chromosome segregation in meiosis protein 3 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=CSM3 PE=3 SV=1 74 193 9.0E-13
sp|O14350|SWI3_SCHPO Swi1-interacting protein swi3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=swi3 PE=1 SV=2 74 132 5.0E-09
[Show less]

GO

GO Term Description Terminal node
GO:0048478 replication fork protection Yes
GO:0005634 nucleus Yes
GO:0006974 cellular response to DNA damage stimulus Yes
GO:0065007 biological regulation No
GO:0009892 negative regulation of metabolic process No
GO:0031323 regulation of cellular metabolic process No
GO:0006950 response to stress No
GO:0006259 DNA metabolic process No
GO:0044237 cellular metabolic process No
GO:0071704 organic substance metabolic process No
GO:0019222 regulation of metabolic process No
GO:2000104 negative regulation of DNA-dependent DNA replication No
GO:0043170 macromolecule metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0050794 regulation of cellular process No
GO:0050896 response to stimulus No
GO:0033554 cellular response to stress No
GO:0044238 primary metabolic process No
GO:0048523 negative regulation of cellular process No
GO:0008152 metabolic process No
GO:0051172 negative regulation of nitrogen compound metabolic process No
GO:0045005 DNA-dependent DNA replication maintenance of fidelity No
GO:0008150 biological_process No
GO:0044260 cellular macromolecule metabolic process No
GO:0046483 heterocycle metabolic process No
GO:0009889 regulation of biosynthetic process No
GO:0010556 regulation of macromolecule biosynthetic process No
GO:0051052 regulation of DNA metabolic process No
GO:0043226 organelle No
GO:0010558 negative regulation of macromolecule biosynthetic process No
GO:0005575 cellular_component No
GO:0060255 regulation of macromolecule metabolic process No
GO:0090329 regulation of DNA-dependent DNA replication No
GO:0043227 membrane-bounded organelle No
GO:0009987 cellular process No
GO:0031324 negative regulation of cellular metabolic process No
GO:0010605 negative regulation of macromolecule metabolic process No
GO:0044424 intracellular part No
GO:0045934 negative regulation of nucleobase-containing compound metabolic process No
GO:0051171 regulation of nitrogen compound metabolic process No
GO:0051716 cellular response to stimulus No
GO:0008156 negative regulation of DNA replication No
GO:0031327 negative regulation of cellular biosynthetic process No
GO:0051053 negative regulation of DNA metabolic process No
GO:0090304 nucleic acid metabolic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0050789 regulation of biological process No
GO:2000113 negative regulation of cellular macromolecule biosynthetic process No
GO:0044464 cell part No
GO:0043231 intracellular membrane-bounded organelle No
GO:0019219 regulation of nucleobase-containing compound metabolic process No
GO:0006275 regulation of DNA replication No
GO:0080090 regulation of primary metabolic process No
GO:2000112 regulation of cellular macromolecule biosynthetic process No
GO:0048519 negative regulation of biological process No
GO:0006139 nucleobase-containing compound metabolic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0009890 negative regulation of biosynthetic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0031326 regulation of cellular biosynthetic process No
GO:0043229 intracellular organelle No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 55 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|7190
MPAALPSARRPPRPDDLDNYGIDDLSDDPFRSPSPSRQQQNPSPSDPEPSRKRKDGLGLDEQVSVQKRARAGGLR
LKGRGHEFSDAGRLLALYQLWLDDLFPKARFLDALAMVERAGHKKRVMAARNAWIAEGRPGGGPADDDDADVDEP
AARDSKDITNDTHQAASTDPRAAPRTPPPPTRDVPDDDDLYDGTPLARPAPRPTTEAEPEADDLDALMAEAEEAD
RGSGGGERVPPDRPSAVLGETGFEDDEAALAEMEGL*
Coding >Hirsu2|7190
ATGCCCGCCGCTCTCCCCTCCGCCCGGCGGCCCCCGCGCCCGGACGACCTCGACAACTACGGCATCGACGACCTC
TCCGACGACCCCTTCCGGTCGCCCAGCCCGTCACGGCAGCAGCAGAACCCGTCGCCTTCGGACCCGGAGCCGTCC
AGGAAGCGCAAGGACGGGCTTGGTCTCGACGAGCAGGTGTCGGTACAGAAGCGCGCGCGCGCCGGCGGCCTGCGC
CTCAAGGGCCGCGGCCACGAGTTCTCCGACGCCGGCCGCCTGCTGGCCCTATACCAGCTCTGGCTCGACGACCTC
TTCCCCAAGGCCCGCTTCCTCGACGCGCTCGCCATGGTCGAGCGGGCCGGCCACAAGAAGCGCGTCATGGCCGCG
CGCAACGCCTGGATCGCCGAGGGCAGGCCCGGCGGGGGCCCGGCCGATGACGACGACGCTGATGTTGACGAGCCC
GCCGCCCGGGACAGCAAGGACATCACCAACGACACACATCAGGCTGCGTCTACAGACCCGCGTGCGGCGCCGCGG
ACGCCCCCCCCTCCGACCCGGGACGTGCCCGACGACGACGATCTGTACGACGGCACGCCTCTGGCGCGCCCGGCC
CCGCGCCCGACGACGGAGGCCGAGCCGGAAGCCGACGATCTGGACGCCCTGATGGCCGAGGCCGAGGAGGCCGAC
AGGGGAAGCGGGGGCGGGGAAAGGGTGCCGCCCGACAGGCCTTCGGCTGTGCTTGGGGAGACGGGCTTCGAGGAC
GACGAGGCGGCCCTGGCGGAGATGGAAGGGCTGTAG
Transcript >Hirsu2|7190
ATGCCCGCCGCTCTCCCCTCCGCCCGGCGGCCCCCGCGCCCGGACGACCTCGACAACTACGGCATCGACGACCTC
TCCGACGACCCCTTCCGGTCGCCCAGCCCGTCACGGCAGCAGCAGAACCCGTCGCCTTCGGACCCGGAGCCGTCC
AGGAAGCGCAAGGACGGGCTTGGTCTCGACGAGCAGGTGTCGGTACAGAAGCGCGCGCGCGCCGGCGGCCTGCGC
CTCAAGGGCCGCGGCCACGAGTTCTCCGACGCCGGCCGCCTGCTGGCCCTATACCAGCTCTGGCTCGACGACCTC
TTCCCCAAGGCCCGCTTCCTCGACGCGCTCGCCATGGTCGAGCGGGCCGGCCACAAGAAGCGCGTCATGGCCGCG
CGCAACGCCTGGATCGCCGAGGGCAGGCCCGGCGGGGGCCCGGCCGATGACGACGACGCTGATGTTGACGAGCCC
GCCGCCCGGGACAGCAAGGACATCACCAACGACACACATCAGGCTGCGTCTACAGACCCGCGTGCGGCGCCGCGG
ACGCCCCCCCCTCCGACCCGGGACGTGCCCGACGACGACGATCTGTACGACGGCACGCCTCTGGCGCGCCCGGCC
CCGCGCCCGACGACGGAGGCCGAGCCGGAAGCCGACGATCTGGACGCCCTGATGGCCGAGGCCGAGGAGGCCGAC
AGGGGAAGCGGGGGCGGGGAAAGGGTGCCGCCCGACAGGCCTTCGGCTGTGCTTGGGGAGACGGGCTTCGAGGAC
GACGAGGCGGCCCTGGCGGAGATGGAAGGGCTGTAG
Gene >Hirsu2|7190
ATGCCCGCCGCTCTCCCCTCCGCCCGGCGGCCCCCGCGCCCGGACGACCTCGACAACTACGGCATCGACGACCTC
TCCGACGACCCCTTCCGGTCGCCCAGCCCGTCACGGCAGCAGCAGAACCCGTCGCCTTCGGACCCGGAGCCGTCC
AGGAAGCGCAAGGACGGGCTTGGTCTCGACGAGCAGGTGTCGGTACAGAAGCGCGCGCGCGCCGGCGGCCTGCGC
CTCAAGGGCCGCGGCCACGAGTTCTCCGACGCCGGCCGCCTGCTGGCCCTATACCAGCTCTGGCTCGACGACCTC
TTCCCCAAGGCCCGCTTCCTCGACGCGCTCGCCATGGTCGAGCGGGCCGGCCACAAGAAGCGCGTCATGGCCGCG
CGCAACGCCTGGATCGCCGAGGGCAGGCCCGGCGGGGGCCCGGCCGATGACGACGACGCTGATGTTGACGAGCCC
GCCGCCCGGGACAGCAAGGACATCACCAACGACACACATCAGGCTGCGTCTACAGACCCGCGTGCGGCGCCGCGG
ACGCCCCCCCCTCCGACCCGGGACGTGCCCGACGACGACGATCTGTACGACGGCACGCCTCTGGCGCGCCCGGCC
CCGCGCCCGACGACGGAGGCCGAGCCGGAAGCCGACGATCTGGACGCCCTGATGGCCGAGGCCGAGGAGGCCGAC
AGGGGAAGCGGGGGCGGGGAAAGGGTGCCGCCCGACAGGCCTTCGGCTGTGCTTGGGGAGACGGGCTTCGAGGAC
GACGAGGCGGCCCTGGCGGAGATGGAAGGGCTGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail