Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|7187
Gene name
LocationContig_403:18590..20082
Strand-
Gene length (bp)1492
Transcript length (bp)1182
Coding sequence length (bp)1182
Protein length (aa) 394

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00026 Asp Eukaryotic aspartyl protease 1.2E-33 69 367
PF14543 TAXi_N Xylanase inhibitor N-terminal 2.7E-07 69 119

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q12303|YPS3_YEAST Aspartic proteinase yapsin-3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPS3 PE=1 SV=1 33 370 3.0E-23
sp|Q8NKB6|OPSB_ASPOR Probable aspartic-type endopeptidase opsB OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=opsB PE=2 SV=1 64 370 2.0E-20
sp|C4YSF6|CARP1_CANAW Candidapepsin-1 OS=Candida albicans (strain WO-1) GN=SAP1 PE=1 SV=1 4 380 1.0E-19
sp|P0CY27|CARP1_CANAL Candidapepsin-1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SAP1 PE=1 SV=1 4 380 4.0E-19
sp|P0CY26|CARP1_CANAX Candidapepsin-1 OS=Candida albicans GN=SAP1 PE=1 SV=1 4 380 2.0E-17
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q12303|YPS3_YEAST Aspartic proteinase yapsin-3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPS3 PE=1 SV=1 33 370 3.0E-23
sp|Q8NKB6|OPSB_ASPOR Probable aspartic-type endopeptidase opsB OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=opsB PE=2 SV=1 64 370 2.0E-20
sp|C4YSF6|CARP1_CANAW Candidapepsin-1 OS=Candida albicans (strain WO-1) GN=SAP1 PE=1 SV=1 4 380 1.0E-19
sp|P0CY27|CARP1_CANAL Candidapepsin-1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SAP1 PE=1 SV=1 4 380 4.0E-19
sp|P0CY26|CARP1_CANAX Candidapepsin-1 OS=Candida albicans GN=SAP1 PE=1 SV=1 4 380 2.0E-17
sp|D4AIS3|OPSB_ARTBC Probable aspartic-type endopeptidase OPSB OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=OPSB PE=3 SV=1 64 370 2.0E-17
sp|D4DFT3|OPSB_TRIVH Probable aspartic-type endopeptidase OPSB OS=Trichophyton verrucosum (strain HKI 0517) GN=OPSB PE=3 SV=1 64 370 2.0E-17
sp|C4YMJ3|CARP2_CANAW Candidapepsin-2 OS=Candida albicans (strain WO-1) GN=SAP2 PE=1 SV=1 32 370 2.0E-17
sp|P0CS83|CARP2_CANAX Candidapepsin-2 OS=Candida albicans GN=SAP2 PE=1 SV=1 32 370 3.0E-17
sp|Q8SQ41|PEPB_CANLF Pepsin B OS=Canis lupus familiaris GN=PGB PE=1 SV=1 71 369 7.0E-17
sp|C4YNQ5|CARP3_CANAW Candidapepsin-3 OS=Candida albicans (strain WO-1) GN=SAP3 PE=1 SV=1 50 380 8.0E-17
sp|P0CY28|CARP3_CANAX Candidapepsin-3 OS=Candida albicans GN=SAP3 PE=1 SV=1 50 380 8.0E-17
sp|P0CY29|CARP3_CANAL Candidapepsin-3 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SAP3 PE=1 SV=1 50 380 8.0E-17
sp|P81497|PEPA_SUNMU Pepsin A OS=Suncus murinus GN=PGA PE=1 SV=2 67 367 9.0E-17
sp|P0DJ06|CARP2_CANAL Candidapepsin-2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SAP2 PE=1 SV=1 32 370 1.0E-16
sp|P04073|PEPC_RAT Gastricsin OS=Rattus norvegicus GN=Pgc PE=1 SV=1 70 369 2.0E-16
sp|Q9GMY7|PEPA_RHIFE Pepsin A OS=Rhinolophus ferrumequinum GN=PGA PE=2 SV=1 71 367 2.0E-16
sp|Q4WDN4|OPSB_ASPFU Probable aspartic-type endopeptidase opsB OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=opsB PE=3 SV=1 64 386 3.0E-16
sp|P43094|CARP5_CANAL Candidapepsin-5 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SAP5 PE=1 SV=1 70 367 4.0E-16
sp|P0DJD9|PEPA5_HUMAN Pepsin A-5 OS=Homo sapiens GN=PGA5 PE=1 SV=1 71 367 5.0E-16
sp|P53379|MKC7_YEAST Aspartic proteinase MKC7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MKC7 PE=1 SV=2 69 370 6.0E-16
sp|Q9D7R7|PEPC_MOUSE Gastricsin OS=Mus musculus GN=Pgc PE=2 SV=1 70 369 7.0E-16
sp|P0DJD8|PEPA3_HUMAN Pepsin A-3 OS=Homo sapiens GN=PGA3 PE=1 SV=1 71 367 8.0E-16
sp|P0DJD7|PEPA4_HUMAN Pepsin A-4 OS=Homo sapiens GN=PGA4 PE=1 SV=1 71 367 8.0E-16
sp|Q9GMY6|PEPA_CANLF Pepsin A OS=Canis lupus familiaris GN=PGA PE=2 SV=1 71 367 2.0E-15
sp|P12630|BAR1_YEAST Barrierpepsin OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BAR1 PE=1 SV=1 71 370 2.0E-15
sp|P27822|PEPA3_RABIT Pepsin-3 OS=Oryctolagus cuniculus PE=2 SV=1 71 358 3.0E-15
sp|P27677|PEPA2_MACFU Pepsin A-2/A-3 OS=Macaca fuscata fuscata PE=1 SV=1 71 367 5.0E-15
sp|P32329|YPS1_YEAST Aspartic proteinase 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPS1 PE=1 SV=2 99 380 2.0E-14
sp|P40583|YPS6_YEAST Aspartic proteinase yapsin-6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPS6 PE=1 SV=1 68 369 2.0E-14
sp|P83495|PAG4_SHEEP Pregnancy-associated glycoprotein 4 OS=Ovis aries PE=1 SV=2 70 367 2.0E-14
sp|P81498|PEPC_SUNMU Gastricsin OS=Suncus murinus GN=PGC PE=1 SV=2 71 369 3.0E-14
sp|C5FS55|CARP_ARTOC Vacuolar protease A OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=PEP2 PE=3 SV=1 55 370 4.0E-14
sp|P22929|CARP_SACFI Acid protease OS=Saccharomycopsis fibuligera GN=PEP1 PE=3 SV=1 51 370 4.0E-14
sp|C5FRQ0|OPSB_ARTOC Probable aspartic-type endopeptidase OPSB OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=OPSB PE=3 SV=1 78 370 4.0E-14
sp|Q29432|PAG1_BOVIN Pregnancy-associated glycoprotein 1 OS=Bos taurus PE=1 SV=1 70 369 7.0E-14
sp|P43095|CARP6_CANAX Candidapepsin-6 OS=Candida albicans GN=SAP6 PE=3 SV=1 70 370 9.0E-14
sp|Q5AC08|CARP6_CANAL Candidapepsin-6 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SAP6 PE=1 SV=1 70 370 1.0E-13
sp|Q9GMY8|PEPA_SORUN Pepsin A OS=Sorex unguiculatus GN=PGA PE=2 SV=1 67 367 1.0E-13
sp|Q28389|PAG_HORSE Pregnancy-associated glycoprotein OS=Equus caballus GN=PAG PE=2 SV=1 71 369 1.0E-13
sp|P43093|CARP4_CANAW Candidapepsin-4 OS=Candida albicans (strain WO-1) GN=SAP4 PE=3 SV=1 70 370 1.0E-13
sp|Q5A8N2|CARP4_CANAL Candidapepsin-4 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SAP4 PE=1 SV=1 70 370 2.0E-13
sp|Q4LAL9|CATD_CANLF Cathepsin D OS=Canis lupus familiaris GN=CTSD PE=2 SV=1 70 369 2.0E-13
sp|P16476|PEPE_CHICK Embryonic pepsinogen OS=Gallus gallus PE=2 SV=1 71 369 2.0E-13
sp|P03954|PEPA1_MACFU Pepsin A-1 OS=Macaca fuscata fuscata GN=PGA PE=1 SV=2 71 367 2.0E-13
sp|P11489|PEPA_MACMU Pepsin A OS=Macaca mulatta GN=PGA PE=2 SV=1 71 367 2.0E-13
sp|P00792|PEPA_BOVIN Pepsin A OS=Bos taurus GN=PGA PE=1 SV=2 71 367 2.0E-13
sp|Q05744|CATD_CHICK Cathepsin D OS=Gallus gallus GN=CTSD PE=1 SV=1 70 368 3.0E-13
sp|Q9GMY4|PEPC_SORUN Gastricsin OS=Sorex unguiculatus GN=PGC PE=2 SV=1 71 369 4.0E-13
sp|Q9N2D4|PEPA_CALJA Pepsin A OS=Callithrix jacchus GN=PGA PE=1 SV=1 67 367 4.0E-13
sp|Q29079|PAG2_PIG Pregnancy-associated glycoprotein 2 OS=Sus scrofa GN=PAG2 PE=2 SV=1 70 334 7.0E-13
sp|D4DEN7|CARP_TRIVH Probable vacuolar protease A OS=Trichophyton verrucosum (strain HKI 0517) GN=PEP2 PE=3 SV=1 55 370 9.0E-13
sp|Q9GMY3|PEPC_RHIFE Gastricsin OS=Rhinolophus ferrumequinum GN=PGC PE=2 SV=1 71 369 1.0E-12
sp|Q9GMY2|PEPC_RABIT Gastricsin OS=Oryctolagus cuniculus GN=PGC PE=2 SV=1 70 368 1.0E-12
sp|P20142|PEPC_HUMAN Gastricsin OS=Homo sapiens GN=PGC PE=1 SV=1 70 369 1.0E-12
sp|Q64411|PEPC_CAVPO Gastricsin OS=Cavia porcellus GN=PGC PE=2 SV=1 70 369 1.0E-12
sp|Q5AEM6|CARP8_CANAL Candidapepsin-8 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SAP8 PE=1 SV=1 57 370 1.0E-12
sp|O42778|CARP8_CANAX Candidapepsin-8 OS=Candida albicans GN=SAP8 PE=3 SV=1 57 370 1.0E-12
sp|P28712|PEPA1_RABIT Pepsin II-1 OS=Oryctolagus cuniculus PE=2 SV=1 71 369 3.0E-12
sp|O42630|CARP_ASPFU Vacuolar protease A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=pep2 PE=2 SV=1 71 370 3.0E-12
sp|P27678|PEPA4_MACFU Pepsin A-4 OS=Macaca fuscata fuscata GN=PGA PE=1 SV=1 71 367 3.0E-12
sp|P03955|PEPC_MACFU Gastricsin (Fragment) OS=Macaca fuscata fuscata GN=PGC PE=1 SV=2 70 369 3.0E-12
sp|Q9N2D2|CHYM_CALJA Chymosin OS=Callithrix jacchus GN=CYM PE=1 SV=1 73 369 3.0E-12
sp|D4B385|CARP_ARTBC Probable vacuolar protease A OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=PEP2 PE=3 SV=1 70 370 3.0E-12
sp|O93428|CATD_CHIHA Cathepsin D OS=Chionodraco hamatus GN=ctsd PE=1 SV=2 70 370 4.0E-12
sp|Q689Z7|PEPC_MONDO Gastricsin OS=Monodelphis domestica GN=PGC PE=2 SV=1 71 369 4.0E-12
sp|Q9N2D3|PEPC_CALJA Gastricsin OS=Callithrix jacchus GN=PGC PE=1 SV=1 70 369 5.0E-12
sp|Q01294|CARP_NEUCR Vacuolar protease A OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=pep-4 PE=3 SV=2 64 370 5.0E-12
sp|P27821|PEPA2_RABIT Pepsin II-2/3 OS=Oryctolagus cuniculus PE=2 SV=1 71 358 8.0E-12
sp|P28713|PEPA4_RABIT Pepsin II-4 OS=Oryctolagus cuniculus PE=2 SV=1 71 358 1.0E-11
sp|P83493|PAG6_SHEEP Pregnancy-associated glycoprotein 6 OS=Ovis aries PE=1 SV=2 68 358 1.0E-11
sp|P24268|CATD_RAT Cathepsin D OS=Rattus norvegicus GN=Ctsd PE=1 SV=1 23 369 2.0E-11
sp|Q28755|PAG1_SHEEP Pregnancy-associated glycoprotein 1 OS=Ovis aries PE=1 SV=1 70 369 3.0E-11
sp|P18242|CATD_MOUSE Cathepsin D OS=Mus musculus GN=Ctsd PE=1 SV=1 32 369 3.0E-11
sp|O09043|NAPSA_MOUSE Napsin-A OS=Mus musculus GN=Napsa PE=1 SV=1 70 364 3.0E-11
sp|Q59VH7|CARP7_CANAL Candidapepsin-7 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SAP7 PE=1 SV=1 41 369 4.0E-11
sp|Q28057|PAG2_BOVIN Pregnancy-associated glycoprotein 2 OS=Bos taurus GN=PAG2 PE=2 SV=1 70 367 4.0E-11
sp|P07339|CATD_HUMAN Cathepsin D OS=Homo sapiens GN=CTSD PE=1 SV=1 70 369 4.0E-11
sp|O42779|CARP9_CANAX Candidapepsin-9 OS=Candida albicans GN=SAP9 PE=3 SV=1 105 367 7.0E-11
sp|P32834|SXA1_SCHPO Aspartic proteinase sxa1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sxa1 PE=3 SV=2 70 368 1.0E-10
sp|P00791|PEPA_PIG Pepsin A OS=Sus scrofa GN=PGA PE=1 SV=3 71 367 1.0E-10
sp|P10977|CARPV_CANAX Vacuolar aspartic protease OS=Candida albicans GN=APR1 PE=3 SV=3 73 370 1.0E-10
sp|P18276|CHYM_SHEEP Chymosin OS=Ovis aries GN=CYM PE=2 SV=1 73 369 3.0E-10
sp|Q9DEX3|CATD_CLUHA Cathepsin D OS=Clupea harengus GN=ctsd PE=1 SV=1 70 369 3.0E-10
sp|P25796|CATE_CAVPO Cathepsin E OS=Cavia porcellus GN=CTSE PE=1 SV=1 67 367 4.0E-10
sp|Q59SU1|CARP9_CANAL Candidapepsin-9 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SAP9 PE=1 SV=1 84 367 6.0E-10
sp|P14091|CATE_HUMAN Cathepsin E OS=Homo sapiens GN=CTSE PE=1 SV=2 65 367 6.0E-10
sp|Q800A0|CATE_LITCT Cathepsin E OS=Lithobates catesbeiana GN=CTSE PE=1 SV=1 29 367 6.0E-10
sp|P70269|CATE_MOUSE Cathepsin E OS=Mus musculus GN=Ctse PE=1 SV=2 67 367 8.0E-10
sp|Q03168|ASPP_AEDAE Lysosomal aspartic protease OS=Aedes aegypti GN=AAEL006169 PE=1 SV=2 73 369 1.0E-09
sp|O96009|NAPSA_HUMAN Napsin-A OS=Homo sapiens GN=NAPSA PE=1 SV=1 70 376 2.0E-09
sp|P27823|PEPAF_RABIT Pepsin F OS=Oryctolagus cuniculus PE=2 SV=1 71 367 2.0E-09
sp|P40782|CYPR1_CYNCA Cyprosin (Fragment) OS=Cynara cardunculus GN=CYPRO1 PE=1 SV=2 70 332 2.0E-09
sp|P56272|PEP2B_GADMO Pepsin-2B OS=Gadus morhua PE=1 SV=1 71 367 3.0E-09
sp|P85137|CARDF_CYNCA Cardosin-F (Fragments) OS=Cynara cardunculus PE=1 SV=1 70 367 5.0E-09
sp|Q00663|CARP_CANTR Candidapepsin OS=Candida tropicalis GN=SAPT1 PE=1 SV=1 54 370 6.0E-09
sp|Q8VYL3|APA2_ARATH Aspartic proteinase A2 OS=Arabidopsis thaliana GN=APA2 PE=2 SV=1 70 332 7.0E-09
sp|P00794|CHYM_BOVIN Chymosin OS=Bos taurus GN=CYM PE=1 SV=3 32 369 8.0E-09
sp|Q9XFX3|CARDA_CYNCA Procardosin-A OS=Cynara cardunculus GN=cardA PE=1 SV=1 71 303 8.0E-09
sp|Q6DYE7|RENI_CANLF Renin OS=Canis lupus familiaris GN=REN PE=2 SV=1 70 370 8.0E-09
sp|P07267|CARP_YEAST Saccharopepsin OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PEP4 PE=1 SV=1 64 369 1.0E-08
sp|P06281|RENI1_MOUSE Renin-1 OS=Mus musculus GN=Ren1 PE=1 SV=1 70 370 1.0E-08
sp|P32950|CARP2_CANPA Candidapepsin-2 OS=Candida parapsilosis GN=SAPP2 PE=1 SV=1 69 377 1.0E-08
sp|P80209|CATD_BOVIN Cathepsin D OS=Bos taurus GN=CTSD PE=1 SV=2 70 369 2.0E-08
sp|O65390|APA1_ARATH Aspartic proteinase A1 OS=Arabidopsis thaliana GN=APA1 PE=1 SV=1 23 332 4.0E-08
sp|O76856|CATD_DICDI Cathepsin D OS=Dictyostelium discoideum GN=ctsD PE=1 SV=1 73 369 4.0E-08
sp|Q29078|PAG1_PIG Pregnancy-associated glycoprotein 1 OS=Sus scrofa PE=2 SV=1 70 358 5.0E-08
sp|Q9XFX4|CARDB_CYNCA Procardosin-B OS=Cynara cardunculus GN=cardB PE=1 SV=1 71 327 5.0E-08
sp|P00793|PEPA_CHICK Pepsin A OS=Gallus gallus GN=PGA PE=1 SV=1 71 358 7.0E-08
sp|P00796|RENI2_MOUSE Renin-2 OS=Mus musculus GN=Ren2 PE=1 SV=1 70 370 1.0E-07
sp|P43232|CARP5_RHINI Rhizopuspepsin-5 OS=Rhizopus niveus PE=3 SV=2 73 358 1.0E-07
sp|D4D8U6|CTSD_TRIVH Probable aspartic-type endopeptidase CTSD OS=Trichophyton verrucosum (strain HKI 0517) GN=CTSD PE=3 SV=1 16 383 1.0E-07
sp|Q9XEC4|APA3_ARATH Aspartic proteinase A3 OS=Arabidopsis thaliana GN=APA3 PE=1 SV=1 70 331 2.0E-07
sp|D4AZK1|CTSD_ARTBC Probable aspartic-type endopeptidase CTSD OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=CTSD PE=3 SV=1 16 393 2.0E-07
sp|O01530|ASP6_CAEEL Aspartic protease 6 OS=Caenorhabditis elegans GN=asp-6 PE=3 SV=1 68 358 2.0E-07
sp|P32951|CARP1_CANPA Candidapepsin-1 OS=Candida parapsilosis GN=SAPP1 PE=1 SV=1 66 370 2.0E-07
sp|P60016|RENI_PANTR Renin OS=Pan troglodytes GN=REN PE=3 SV=1 70 236 2.0E-07
sp|P00797|RENI_HUMAN Renin OS=Homo sapiens GN=REN PE=1 SV=1 70 236 2.0E-07
sp|Q9MZS8|CATD_SHEEP Cathepsin D (Fragment) OS=Ovis aries GN=CTSD PE=1 SV=1 70 301 3.0E-07
sp|P42211|ASPRX_ORYSJ Aspartic proteinase OS=Oryza sativa subsp. japonica GN=RAP PE=2 SV=2 3 303 5.0E-07
sp|P43096|CARP7_CANAX Candidapepsin-7 OS=Candida albicans GN=SAP7 PE=3 SV=1 41 369 6.0E-07
sp|P43159|CATE_RABIT Cathepsin E OS=Oryctolagus cuniculus GN=CTSE PE=2 SV=1 67 367 7.0E-07
sp|Q6DLW5|RENI_MACMU Renin OS=Macaca mulatta GN=REN PE=2 SV=2 70 236 7.0E-07
sp|Q6DLS0|RENI_MACFA Renin OS=Macaca fascicularis GN=REN PE=2 SV=1 70 236 8.0E-07
sp|P55956|ASP3_CAEEL Aspartic protease 3 OS=Caenorhabditis elegans GN=asp-3 PE=1 SV=3 73 370 1.0E-06
sp|Q9TSZ1|RENI_CALJA Renin OS=Callithrix jacchus GN=REN PE=2 SV=1 70 236 1.0E-06
sp|P52115|RENI_SHEEP Renin OS=Ovis aries GN=REN PE=2 SV=1 70 370 2.0E-06
sp|Q42456|ASPR1_ORYSJ Aspartic proteinase oryzasin-1 OS=Oryza sativa subsp. japonica GN=Os05g0567100 PE=2 SV=2 70 332 2.0E-06
sp|P08424|RENI_RAT Renin OS=Rattus norvegicus GN=Ren1 PE=2 SV=2 70 370 2.0E-06
sp|Q5A651|CAR10_CANAL Candidapepsin-10 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SAP10 PE=1 SV=1 52 367 2.0E-06
sp|Q03699|CARP3_RHINI Rhizopuspepsin-3 OS=Rhizopus niveus PE=3 SV=1 73 367 3.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 17 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|7187
MWRSLLFLATPSLSSPTLYYRGNRGAAELNGVIRVPLTASSSDSSAASVVRRQIKAPLKHASFHRLPLINLGIGT
PPQSVSLVFDTGSTFLWVHPVCDAADFRPSCKNTARFNTSASRTFWDSETAIPAYYGLGDISQTVLAISKDFMFS
GNTSLGDIGFGVAEKWNRIPYGILGAAPNMKQQVLSFLHYIVHSGAVKNKIFGLDVPASDRDQGAVIFSGIDTKK
FSGPLEKLPIIPEDESPDNYPRYWIYLDGMTIKQANGSDIASISAANRQPVILDSGSEDAHLPSDVVDEIYQAFS
SDGGAVDCSTRNSNGTIDFAFGKTIIQTPIADFIVSQNGKYIYILGSHFLQSAYVVFDWDSGNVWVASSRDCGSN
VQPVTGTPDSLEPHIGEC*
Coding >Hirsu2|7187
ATGTGGCGCTCTCTGCTGTTCTTAGCGACCCCATCGCTAAGTTCTCCCACTTTATATTATCGCGGCAATCGCGGC
GCTGCCGAACTGAACGGAGTAATACGTGTGCCGCTCACGGCGTCTTCGTCGGACTCATCCGCCGCGAGCGTGGTG
AGAAGACAGATAAAGGCTCCCCTGAAGCATGCATCATTCCATCGTCTTCCTCTCATCAATCTCGGCATAGGCACT
CCTCCGCAAAGCGTCAGCCTCGTTTTCGATACAGGTTCTACGTTTCTGTGGGTACACCCTGTCTGTGATGCAGCG
GACTTCCGGCCCAGCTGCAAAAATACTGCACGGTTCAACACCAGTGCTAGCAGAACCTTTTGGGATAGTGAAACT
GCTATACCAGCATATTATGGCCTTGGAGACATTTCGCAAACTGTCCTTGCTATTTCAAAGGACTTTATGTTTAGT
GGAAACACTTCGCTTGGTGACATTGGCTTCGGGGTAGCGGAAAAATGGAATAGAATCCCATATGGCATTCTTGGT
GCTGCTCCTAACATGAAACAACAGGTTCTCTCGTTCCTCCACTACATTGTTCACTCAGGCGCCGTTAAGAACAAG
ATTTTCGGCCTCGATGTCCCTGCCTCCGACCGCGACCAAGGCGCCGTCATCTTCAGCGGAATTGACACCAAAAAG
TTCTCCGGCCCTTTAGAGAAACTACCCATCATTCCTGAAGATGAGAGTCCCGATAACTATCCACGGTACTGGATC
TACCTTGACGGAATGACAATCAAGCAAGCCAATGGCAGCGACATAGCGTCGATCTCAGCGGCTAATCGCCAACCT
GTCATATTAGATAGCGGCAGTGAAGATGCGCATTTGCCCAGCGACGTTGTGGACGAGATCTACCAAGCATTCTCG
TCCGACGGCGGTGCCGTGGATTGTTCTACGCGAAACTCAAACGGGACCATCGACTTCGCCTTCGGAAAGACAATC
ATCCAGACACCTATTGCCGACTTCATCGTCTCTCAAAATGGCAAATACATTTATATCCTGGGTTCGCACTTTCTT
CAGAGCGCGTACGTTGTCTTTGACTGGGACAGTGGCAACGTGTGGGTGGCTTCGAGCCGTGATTGCGGCTCCAAT
GTTCAGCCTGTCACCGGCACTCCTGACTCTCTCGAACCTCACATAGGTGAATGCTGA
Transcript >Hirsu2|7187
ATGTGGCGCTCTCTGCTGTTCTTAGCGACCCCATCGCTAAGTTCTCCCACTTTATATTATCGCGGCAATCGCGGC
GCTGCCGAACTGAACGGAGTAATACGTGTGCCGCTCACGGCGTCTTCGTCGGACTCATCCGCCGCGAGCGTGGTG
AGAAGACAGATAAAGGCTCCCCTGAAGCATGCATCATTCCATCGTCTTCCTCTCATCAATCTCGGCATAGGCACT
CCTCCGCAAAGCGTCAGCCTCGTTTTCGATACAGGTTCTACGTTTCTGTGGGTACACCCTGTCTGTGATGCAGCG
GACTTCCGGCCCAGCTGCAAAAATACTGCACGGTTCAACACCAGTGCTAGCAGAACCTTTTGGGATAGTGAAACT
GCTATACCAGCATATTATGGCCTTGGAGACATTTCGCAAACTGTCCTTGCTATTTCAAAGGACTTTATGTTTAGT
GGAAACACTTCGCTTGGTGACATTGGCTTCGGGGTAGCGGAAAAATGGAATAGAATCCCATATGGCATTCTTGGT
GCTGCTCCTAACATGAAACAACAGGTTCTCTCGTTCCTCCACTACATTGTTCACTCAGGCGCCGTTAAGAACAAG
ATTTTCGGCCTCGATGTCCCTGCCTCCGACCGCGACCAAGGCGCCGTCATCTTCAGCGGAATTGACACCAAAAAG
TTCTCCGGCCCTTTAGAGAAACTACCCATCATTCCTGAAGATGAGAGTCCCGATAACTATCCACGGTACTGGATC
TACCTTGACGGAATGACAATCAAGCAAGCCAATGGCAGCGACATAGCGTCGATCTCAGCGGCTAATCGCCAACCT
GTCATATTAGATAGCGGCAGTGAAGATGCGCATTTGCCCAGCGACGTTGTGGACGAGATCTACCAAGCATTCTCG
TCCGACGGCGGTGCCGTGGATTGTTCTACGCGAAACTCAAACGGGACCATCGACTTCGCCTTCGGAAAGACAATC
ATCCAGACACCTATTGCCGACTTCATCGTCTCTCAAAATGGCAAATACATTTATATCCTGGGTTCGCACTTTCTT
CAGAGCGCGTACGTTGTCTTTGACTGGGACAGTGGCAACGTGTGGGTGGCTTCGAGCCGTGATTGCGGCTCCAAT
GTTCAGCCTGTCACCGGCACTCCTGACTCTCTCGAACCTCACATAGGTGAATGCTGA
Gene >Hirsu2|7187
ATGTGGCGCTCTCTGCTGTTCTTAGCGACCCCATCGCTAAGTTCTCCCACTTTATATTATCGCGGCAATCGCGGC
GCTGCCGAACTGAACGGAGTAATACGTGTGCCGCTCACGGCGTCTTCGTCGGACTCATCCGCCGCGAGCGTGGTG
AGAAGACAGATAAAGGCTCCCCTGAAGCATGCATCATTCCATCGTCTTCCTCTCATCAATCTCGGCATAGGCACT
CCTCCGCAAAGCGTCAGCCTCGTTTTCGATACAGGTTCTACGTTTCTGTGGGTACACCCTGTCTGTGATGCAGCG
GACTTCCGGCCCAGCTGCAAAAATACTGCACGGTTCAACACCAGTGCTAGCAGAACCTTTTGGGATAGTGAAACT
GCTATACCAGCATATTATGGCCTTGGAGACATTTCGCAAACTGTCCTTGCTATTTCAAAGGACTTTATGTTTAGT
GGAAGTACGTATGACATATGCTGTATGCATCGTTGTCTATCGACCTTGCAGACATGGATACTCATACGAACCACC
CGTCACTAAACGACTATTATGTATAGACACTTCGCTTGGTGACATTGGCTTCGGGGTAGCGGAAAAATGGAATAG
AATCCCATATGGCATTCTTGGTGCTGCTCCTAACATGAAACAACAGGTTCTCTCGTTCCTCCACTACATTGTTCA
CTCAGGCGCCGTTAAGAACAAGATTTTCGGCCTCGATGTCCCTGCCTCCGACCGCGACCAAGGTGGGCTACGTGC
GGTACAGATATGAAGGACGGGCTGTCTGGTAGTTAATAACGTGTAACAGGCGCCGTCATCTTCAGCGGAATTGAC
ACCAAAAAGTTCTCCGGCCCTTTAGAGAAACTACCCATCATTCCTGAAGATGAGAGTCCCGATAACTATCCACGG
TTCGCTTTTCAGCTATCCTTGTAAAGGTATCGTCGCTTACGGTCAGAATAGGTACTGGATCTACCTTGACGGAAT
GACAATCAAGCAAGCCAATGGCAGCGACATAGCGTCGATCTCAGCGGCTAATCGCCAACCTGTCATATTAGATAG
CGGCAGTGAAGATGCGCATTTGCCCAGCGACGTTGTGGACGAGATCTACCAAGCATTCTCGTCCGACGGCGGTGC
CGTGGATTGTTCTACGCGAAACTCAAACGGGACCATCGACTTCGCCTTCGGAAAGACAATCATCCAGACACCTAT
TGCCGACTTCATCGTCTCTCAAAATGGCAAATGTAGGCTGGCGGTCGCGAAATCAAGCCAAAGTGCGTTCAAGTC
CCCTGCAATGACACACAGGTACAGCTTGGCGAGGGGCAACTTACAAAAGTAAGCAGACATTTATATCCTGGGTTC
GCACTTTCTTCAGAGCGCGTACGTTGTCTTTGACTGGGACAGTGGCAACGTGTGGGTGGCTTCGAGCCGTGATTG
CGGCTCCAATGTTCAGCCTGTCACCGGCACTCCTGACTCTCTCGAACCTCACATAGGTGAATGCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail