Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|7184
Gene name
LocationContig_402:20094..20787
Strand-
Gene length (bp)693
Transcript length (bp)693
Coding sequence length (bp)693
Protein length (aa) 231

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 2.0E-11 8 167
PF07690 MFS_1 Major Facilitator Superfamily 8.7E-10 90 226

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q08902|YO378_YEAST Drug resistance protein YOR378W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YOR378W PE=1 SV=1 8 224 6.0E-69
sp|Q9P6J7|YHD3_SCHPO Uncharacterized MFS-type transporter C1683.03c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1683.03c PE=3 SV=1 1 226 2.0E-63
sp|Q03263|YM8M_YEAST Uncharacterized transporter YMR279C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YMR279C PE=1 SV=1 4 225 4.0E-41
sp|P13090|ATR1_YEAST Aminotriazole resistance protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ATR1 PE=1 SV=2 1 227 8.0E-40

GO

GO Term Description Terminal node
GO:0055085 transmembrane transport Yes
GO:0022857 transmembrane transporter activity Yes
GO:0009987 cellular process No
GO:0051179 localization No
GO:0005215 transporter activity No
GO:0008150 biological_process No
GO:0051234 establishment of localization No
GO:0003674 molecular_function No
GO:0006810 transport No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cell membrane|Lysosome/Vacuole Transmembrane domain 0.1597 0.0647 0.0381 0.7095 0.1432 0.0075 0.4466 0.6586 0.2255 0.0263

SignalP

(None)

Transmembrane Domains

Domain # Start End Length
1 20 42 22
2 55 77 22
3 87 109 22
4 118 140 22
5 150 172 22
6 193 215 22

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup3696
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2383
Ophiocordyceps australis map64 (Brazil) OphauB2|3834
Ophiocordyceps camponoti-floridani Ophcf2|04541
Ophiocordyceps camponoti-rufipedis Ophun1|6929
Ophiocordyceps kimflemingae Ophio5|703
Ophiocordyceps subramaniannii Hirsu2|7184 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|7184
MLVEVRLSRAPLLPLDAVNAEVAFVLAAVVCGWATFGVWTLYLTQMLQDIRQLSPLLTTAWFSPVAVSGALAAVV
TGKLLGPLQVRPPAVMTLALVAFTVGVVLAAFAPVDQTYWGQVFVSVVVMPAGMDMSFPAATLILSNAVAKEHQG
IGASLVSTVVNYGIALGVGFAGTVETHVRGDRDTREGRLKGYRGALYMGIGLAGLGLLVCLTFLFREHFSRRRKS
AADIA*
Coding >Hirsu2|7184
ATGCTGGTCGAGGTCCGGCTGAGCCGGGCGCCGCTGCTGCCGCTCGACGCCGTCAACGCCGAGGTCGCCTTCGTC
CTGGCCGCCGTCGTCTGCGGCTGGGCCACCTTCGGCGTCTGGACGCTGTACCTGACCCAGATGCTGCAGGACATC
CGCCAGCTGTCGCCGCTGCTGACGACGGCCTGGTTCAGCCCGGTCGCCGTCTCGGGCGCGCTGGCCGCCGTCGTC
ACCGGCAAGCTGCTCGGCCCGCTGCAGGTCCGGCCGCCGGCCGTCATGACGCTGGCCCTCGTCGCCTTCACCGTC
GGCGTCGTCCTCGCCGCCTTCGCCCCGGTCGACCAGACGTACTGGGGCCAGGTCTTCGTCTCCGTCGTCGTCATG
CCGGCCGGCATGGACATGTCCTTCCCGGCCGCCACCCTGATCCTGTCCAACGCGGTCGCCAAGGAGCACCAGGGC
ATCGGCGCCAGCCTCGTCAGCACCGTCGTCAACTACGGCATCGCCCTCGGCGTCGGCTTCGCCGGCACCGTCGAG
ACTCACGTCCGGGGCGACCGAGACACCCGCGAGGGCCGGCTCAAGGGATATCGCGGCGCGCTCTACATGGGCATC
GGCCTCGCCGGACTCGGCCTCCTCGTCTGCCTGACCTTTCTCTTCAGAGAGCACTTCTCGAGGAGACGAAAGTCT
GCCGCCGACATTGCCTGA
Transcript >Hirsu2|7184
ATGCTGGTCGAGGTCCGGCTGAGCCGGGCGCCGCTGCTGCCGCTCGACGCCGTCAACGCCGAGGTCGCCTTCGTC
CTGGCCGCCGTCGTCTGCGGCTGGGCCACCTTCGGCGTCTGGACGCTGTACCTGACCCAGATGCTGCAGGACATC
CGCCAGCTGTCGCCGCTGCTGACGACGGCCTGGTTCAGCCCGGTCGCCGTCTCGGGCGCGCTGGCCGCCGTCGTC
ACCGGCAAGCTGCTCGGCCCGCTGCAGGTCCGGCCGCCGGCCGTCATGACGCTGGCCCTCGTCGCCTTCACCGTC
GGCGTCGTCCTCGCCGCCTTCGCCCCGGTCGACCAGACGTACTGGGGCCAGGTCTTCGTCTCCGTCGTCGTCATG
CCGGCCGGCATGGACATGTCCTTCCCGGCCGCCACCCTGATCCTGTCCAACGCGGTCGCCAAGGAGCACCAGGGC
ATCGGCGCCAGCCTCGTCAGCACCGTCGTCAACTACGGCATCGCCCTCGGCGTCGGCTTCGCCGGCACCGTCGAG
ACTCACGTCCGGGGCGACCGAGACACCCGCGAGGGCCGGCTCAAGGGATATCGCGGCGCGCTCTACATGGGCATC
GGCCTCGCCGGACTCGGCCTCCTCGTCTGCCTGACCTTTCTCTTCAGAGAGCACTTCTCGAGGAGACGAAAGTCT
GCCGCCGACATTGCCTGA
Gene >Hirsu2|7184
ATGCTGGTCGAGGTCCGGCTGAGCCGGGCGCCGCTGCTGCCGCTCGACGCCGTCAACGCCGAGGTCGCCTTCGTC
CTGGCCGCCGTCGTCTGCGGCTGGGCCACCTTCGGCGTCTGGACGCTGTACCTGACCCAGATGCTGCAGGACATC
CGCCAGCTGTCGCCGCTGCTGACGACGGCCTGGTTCAGCCCGGTCGCCGTCTCGGGCGCGCTGGCCGCCGTCGTC
ACCGGCAAGCTGCTCGGCCCGCTGCAGGTCCGGCCGCCGGCCGTCATGACGCTGGCCCTCGTCGCCTTCACCGTC
GGCGTCGTCCTCGCCGCCTTCGCCCCGGTCGACCAGACGTACTGGGGCCAGGTCTTCGTCTCCGTCGTCGTCATG
CCGGCCGGCATGGACATGTCCTTCCCGGCCGCCACCCTGATCCTGTCCAACGCGGTCGCCAAGGAGCACCAGGGC
ATCGGCGCCAGCCTCGTCAGCACCGTCGTCAACTACGGCATCGCCCTCGGCGTCGGCTTCGCCGGCACCGTCGAG
ACTCACGTCCGGGGCGACCGAGACACCCGCGAGGGCCGGCTCAAGGGATATCGCGGCGCGCTCTACATGGGCATC
GGCCTCGCCGGACTCGGCCTCCTCGTCTGCCTGACCTTTCTCTTCAGAGAGCACTTCTCGAGGAGACGAAAGTCT
GCCGCCGACATTGCCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail