Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|7184
Gene name
LocationContig_402:20094..20787
Strand-
Gene length (bp)693
Transcript length (bp)693
Coding sequence length (bp)693
Protein length (aa) 231

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 1.8E-11 8 167
PF07690 MFS_1 Major Facilitator Superfamily 8.0E-10 90 226

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q08902|YO378_YEAST Drug resistance protein YOR378W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YOR378W PE=1 SV=1 8 224 6.0E-69
sp|Q9P6J7|YHD3_SCHPO Uncharacterized MFS-type transporter C1683.03c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1683.03c PE=3 SV=1 1 226 2.0E-63
sp|Q03263|YM8M_YEAST Uncharacterized transporter YMR279C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YMR279C PE=1 SV=1 4 225 4.0E-41
sp|P13090|ATR1_YEAST Aminotriazole resistance protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ATR1 PE=1 SV=2 1 227 8.0E-40

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0055085 transmembrane transport Yes
GO:0031224 intrinsic component of membrane No
GO:0008150 biological_process No
GO:0006810 transport No
GO:0051179 localization No
GO:0051234 establishment of localization No
GO:0044425 membrane part No
GO:0005575 cellular_component No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 21 0.5

Transmembrane Domains

Domain # Start End Length
1 20 42 22
2 55 77 22
3 87 109 22
4 118 140 22
5 150 172 22
6 193 215 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|7184
MLVEVRLSRAPLLPLDAVNAEVAFVLAAVVCGWATFGVWTLYLTQMLQDIRQLSPLLTTAWFSPVAVSGALAAVV
TGKLLGPLQVRPPAVMTLALVAFTVGVVLAAFAPVDQTYWGQVFVSVVVMPAGMDMSFPAATLILSNAVAKEHQG
IGASLVSTVVNYGIALGVGFAGTVETHVRGDRDTREGRLKGYRGALYMGIGLAGLGLLVCLTFLFREHFSRRRKS
AADIA*
Coding >Hirsu2|7184
ATGCTGGTCGAGGTCCGGCTGAGCCGGGCGCCGCTGCTGCCGCTCGACGCCGTCAACGCCGAGGTCGCCTTCGTC
CTGGCCGCCGTCGTCTGCGGCTGGGCCACCTTCGGCGTCTGGACGCTGTACCTGACCCAGATGCTGCAGGACATC
CGCCAGCTGTCGCCGCTGCTGACGACGGCCTGGTTCAGCCCGGTCGCCGTCTCGGGCGCGCTGGCCGCCGTCGTC
ACCGGCAAGCTGCTCGGCCCGCTGCAGGTCCGGCCGCCGGCCGTCATGACGCTGGCCCTCGTCGCCTTCACCGTC
GGCGTCGTCCTCGCCGCCTTCGCCCCGGTCGACCAGACGTACTGGGGCCAGGTCTTCGTCTCCGTCGTCGTCATG
CCGGCCGGCATGGACATGTCCTTCCCGGCCGCCACCCTGATCCTGTCCAACGCGGTCGCCAAGGAGCACCAGGGC
ATCGGCGCCAGCCTCGTCAGCACCGTCGTCAACTACGGCATCGCCCTCGGCGTCGGCTTCGCCGGCACCGTCGAG
ACTCACGTCCGGGGCGACCGAGACACCCGCGAGGGCCGGCTCAAGGGATATCGCGGCGCGCTCTACATGGGCATC
GGCCTCGCCGGACTCGGCCTCCTCGTCTGCCTGACCTTTCTCTTCAGAGAGCACTTCTCGAGGAGACGAAAGTCT
GCCGCCGACATTGCCTGA
Transcript >Hirsu2|7184
ATGCTGGTCGAGGTCCGGCTGAGCCGGGCGCCGCTGCTGCCGCTCGACGCCGTCAACGCCGAGGTCGCCTTCGTC
CTGGCCGCCGTCGTCTGCGGCTGGGCCACCTTCGGCGTCTGGACGCTGTACCTGACCCAGATGCTGCAGGACATC
CGCCAGCTGTCGCCGCTGCTGACGACGGCCTGGTTCAGCCCGGTCGCCGTCTCGGGCGCGCTGGCCGCCGTCGTC
ACCGGCAAGCTGCTCGGCCCGCTGCAGGTCCGGCCGCCGGCCGTCATGACGCTGGCCCTCGTCGCCTTCACCGTC
GGCGTCGTCCTCGCCGCCTTCGCCCCGGTCGACCAGACGTACTGGGGCCAGGTCTTCGTCTCCGTCGTCGTCATG
CCGGCCGGCATGGACATGTCCTTCCCGGCCGCCACCCTGATCCTGTCCAACGCGGTCGCCAAGGAGCACCAGGGC
ATCGGCGCCAGCCTCGTCAGCACCGTCGTCAACTACGGCATCGCCCTCGGCGTCGGCTTCGCCGGCACCGTCGAG
ACTCACGTCCGGGGCGACCGAGACACCCGCGAGGGCCGGCTCAAGGGATATCGCGGCGCGCTCTACATGGGCATC
GGCCTCGCCGGACTCGGCCTCCTCGTCTGCCTGACCTTTCTCTTCAGAGAGCACTTCTCGAGGAGACGAAAGTCT
GCCGCCGACATTGCCTGA
Gene >Hirsu2|7184
ATGCTGGTCGAGGTCCGGCTGAGCCGGGCGCCGCTGCTGCCGCTCGACGCCGTCAACGCCGAGGTCGCCTTCGTC
CTGGCCGCCGTCGTCTGCGGCTGGGCCACCTTCGGCGTCTGGACGCTGTACCTGACCCAGATGCTGCAGGACATC
CGCCAGCTGTCGCCGCTGCTGACGACGGCCTGGTTCAGCCCGGTCGCCGTCTCGGGCGCGCTGGCCGCCGTCGTC
ACCGGCAAGCTGCTCGGCCCGCTGCAGGTCCGGCCGCCGGCCGTCATGACGCTGGCCCTCGTCGCCTTCACCGTC
GGCGTCGTCCTCGCCGCCTTCGCCCCGGTCGACCAGACGTACTGGGGCCAGGTCTTCGTCTCCGTCGTCGTCATG
CCGGCCGGCATGGACATGTCCTTCCCGGCCGCCACCCTGATCCTGTCCAACGCGGTCGCCAAGGAGCACCAGGGC
ATCGGCGCCAGCCTCGTCAGCACCGTCGTCAACTACGGCATCGCCCTCGGCGTCGGCTTCGCCGGCACCGTCGAG
ACTCACGTCCGGGGCGACCGAGACACCCGCGAGGGCCGGCTCAAGGGATATCGCGGCGCGCTCTACATGGGCATC
GGCCTCGCCGGACTCGGCCTCCTCGTCTGCCTGACCTTTCTCTTCAGAGAGCACTTCTCGAGGAGACGAAAGTCT
GCCGCCGACATTGCCTGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail