Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|7182
Gene name
LocationContig_402:17786..18326
Strand-
Gene length (bp)540
Transcript length (bp)540
Coding sequence length (bp)540
Protein length (aa) 180

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12296 HsbA Hydrophobic surface binding protein A 2.0E-19 27 143

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O42721|MP1_TALMA Cell wall mannoprotein 1 OS=Talaromyces marneffei GN=MP1 PE=1 SV=1 1 171 2.0E-10
sp|Q8TG42|MP1_ASPFL Cell wall mannoprotein 1 OS=Aspergillus flavus GN=mp1 PE=2 SV=1 1 155 3.0E-08

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 19 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|7182
MKFTAQVALVCLAAGAYAGPVIQRNLSTIKQELVKIQDGIDKLDQAAKNVKGNPGVVIASADALIHTIVTSTATV
QGTSPVTIEDAVKLLGPVQDLVKHGKTLHQDFVNERSDIAKAGQCKTTREKIGSIKDEASKCIDVIVSKVEEKAR
SIARNEANKVIQELNEAVADFGPDKCRDA*
Coding >Hirsu2|7182
ATGAAGTTCACCGCCCAGGTCGCTCTCGTCTGCCTCGCCGCCGGCGCCTACGCCGGACCCGTCATCCAGCGCAAC
CTCTCGACCATCAAACAGGAGCTCGTCAAGATCCAGGACGGCATCGACAAGCTCGACCAGGCCGCCAAGAACGTC
AAGGGGAACCCGGGAGTCGTCATCGCCTCCGCCGACGCTCTCATCCATACCATCGTCACCAGCACCGCAACCGTC
CAGGGCACCTCGCCGGTCACGATCGAGGACGCCGTCAAGCTGTTGGGGCCGGTCCAGGACCTGGTGAAGCACGGC
AAGACCCTGCACCAAGACTTCGTCAACGAGCGGTCCGACATCGCCAAGGCTGGGCAGTGCAAAACGACGCGTGAA
AAGATCGGCAGCATCAAGGACGAAGCCTCCAAGTGCATCGATGTCATCGTCTCAAAGGTGGAGGAAAAGGCCCGG
TCAATCGCCCGGAACGAGGCCAACAAGGTTATCCAAGAGTTGAACGAGGCAGTGGCCGACTTTGGTCCGGACAAG
TGCCGCGACGCATAA
Transcript >Hirsu2|7182
ATGAAGTTCACCGCCCAGGTCGCTCTCGTCTGCCTCGCCGCCGGCGCCTACGCCGGACCCGTCATCCAGCGCAAC
CTCTCGACCATCAAACAGGAGCTCGTCAAGATCCAGGACGGCATCGACAAGCTCGACCAGGCCGCCAAGAACGTC
AAGGGGAACCCGGGAGTCGTCATCGCCTCCGCCGACGCTCTCATCCATACCATCGTCACCAGCACCGCAACCGTC
CAGGGCACCTCGCCGGTCACGATCGAGGACGCCGTCAAGCTGTTGGGGCCGGTCCAGGACCTGGTGAAGCACGGC
AAGACCCTGCACCAAGACTTCGTCAACGAGCGGTCCGACATCGCCAAGGCTGGGCAGTGCAAAACGACGCGTGAA
AAGATCGGCAGCATCAAGGACGAAGCCTCCAAGTGCATCGATGTCATCGTCTCAAAGGTGGAGGAAAAGGCCCGG
TCAATCGCCCGGAACGAGGCCAACAAGGTTATCCAAGAGTTGAACGAGGCAGTGGCCGACTTTGGTCCGGACAAG
TGCCGCGACGCATAA
Gene >Hirsu2|7182
ATGAAGTTCACCGCCCAGGTCGCTCTCGTCTGCCTCGCCGCCGGCGCCTACGCCGGACCCGTCATCCAGCGCAAC
CTCTCGACCATCAAACAGGAGCTCGTCAAGATCCAGGACGGCATCGACAAGCTCGACCAGGCCGCCAAGAACGTC
AAGGGGAACCCGGGAGTCGTCATCGCCTCCGCCGACGCTCTCATCCATACCATCGTCACCAGCACCGCAACCGTC
CAGGGCACCTCGCCGGTCACGATCGAGGACGCCGTCAAGCTGTTGGGGCCGGTCCAGGACCTGGTGAAGCACGGC
AAGACCCTGCACCAAGACTTCGTCAACGAGCGGTCCGACATCGCCAAGGCTGGGCAGTGCAAAACGACGCGTGAA
AAGATCGGCAGCATCAAGGACGAAGCCTCCAAGTGCATCGATGTCATCGTCTCAAAGGTGGAGGAAAAGGCCCGG
TCAATCGCCCGGAACGAGGCCAACAAGGTTATCCAAGAGTTGAACGAGGCAGTGGCCGACTTTGGTCCGGACAAG
TGCCGCGACGCATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail