Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|7171
Gene name
LocationContig_400:19146..20003
Strand-
Gene length (bp)857
Transcript length (bp)534
Coding sequence length (bp)534
Protein length (aa) 178

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00300 His_Phos_1 Histidine phosphatase superfamily (branch 1) 4.7E-18 22 154

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P36136|SHB17_YEAST Sedoheptulose 1,7-bisphosphatase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SHB17 PE=1 SV=1 25 166 7.0E-33

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 23 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|7171
LGIAGPLPWNAYGKGPRDGLACDARVEVTEDVREWDYGDYEGITSKEIRKIRADQGLTGTWDIWRDGCPGGESPD
QVTQRLDRVIAEIREKWHQPAMSRGREEAAGESGDVLIVAHGHILRAFALRWAGKTLQEGPTFLLEAGGLGTLSY
EHHSIEEPAILLGGAFHVDIDEQANQQ*
Coding >Hirsu2|7171
CTGGGCATTGCGGGACCCCTCCCATGGAACGCCTACGGCAAAGGCCCGCGTGACGGACTGGCGTGCGACGCCAGG
GTCGAGGTTACCGAGGACGTTCGCGAGTGGGACTACGGCGACTACGAGGGCATCACGAGCAAGGAGATCCGGAAG
ATACGGGCCGATCAGGGCCTCACGGGCACGTGGGACATTTGGCGCGATGGCTGTCCCGGTGGAGAGAGCCCCGAC
CAGGTGACACAGAGACTGGACAGGGTCATTGCTGAGATTCGAGAGAAGTGGCACCAGCCGGCCATGAGCCGCGGC
CGTGAAGAAGCGGCGGGCGAGAGCGGCGACGTGCTCATCGTCGCCCACGGCCACATCCTCCGCGCCTTTGCCCTG
CGCTGGGCCGGCAAGACTCTGCAGGAGGGTCCGACCTTTCTCCTGGAAGCCGGAGGCCTCGGCACCCTGAGCTAC
GAGCACCACAGTATAGAGGAGCCGGCCATTCTTCTCGGTGGCGCATTTCACGTTGATATTGACGAGCAGGCAAAT
CAGCAGTGA
Transcript >Hirsu2|7171
CTGGGCATTGCGGGACCCCTCCCATGGAACGCCTACGGCAAAGGCCCGCGTGACGGACTGGCGTGCGACGCCAGG
GTCGAGGTTACCGAGGACGTTCGCGAGTGGGACTACGGCGACTACGAGGGCATCACGAGCAAGGAGATCCGGAAG
ATACGGGCCGATCAGGGCCTCACGGGCACGTGGGACATTTGGCGCGATGGCTGTCCCGGTGGAGAGAGCCCCGAC
CAGGTGACACAGAGACTGGACAGGGTCATTGCTGAGATTCGAGAGAAGTGGCACCAGCCGGCCATGAGCCGCGGC
CGTGAAGAAGCGGCGGGCGAGAGCGGCGACGTGCTCATCGTCGCCCACGGCCACATCCTCCGCGCCTTTGCCCTG
CGCTGGGCCGGCAAGACTCTGCAGGAGGGTCCGACCTTTCTCCTGGAAGCCGGAGGCCTCGGCACCCTGAGCTAC
GAGCACCACAGTATAGAGGAGCCGGCCATTCTTCTCGGTGGCGCATTTCACGTTGATATTGACGAGCAGGCAAAT
CAGCAGTGA
Gene >Hirsu2|7171
CTGGGCATTGCGGGACCCCTCCCATGGAACGCCTACGGCAAAGGCCCGCGTGACGGACTGGCGTGCGACGCCAGG
GTCGAGGTTACCGAGGACGTTCGCGAGTGGGACTACGGCGACTACGAGGGCATCACGAGCAAGGAGATCCGGAAG
ATACGGGCCGATCAGGGCCTCACGGGCACGTGGGACATTTGGCGCGATGGCTGTCCCGGTGGAGAGTGAGTCAAC
TGTCGGCCTGATAGGGTCTCTTACTGCCCCTTGATCNNCCCCCTTTTCCCCCCCCCCCCCCCTTTTTTTTTTCGT
CTTACACGAAGATGACCTTGTCTTCCTTCATGTACTGGACACTGCACCTTGAGCCTCGACTCCGAAACGGCACGG
TCCCGAGTTACAGAAAGGGTGGCGCCCAGGCTGACAGGAGCTGGACGAGAAAGGAGCCCCGACCAGGTGACACAG
AGACTGGACAGGGTCATTGCTGAGATTCGAGAGAAGTGGCACCAGCCGGCCATGAGCCGCGGCCGTGAAGAAGCG
GCGGGCGAGAGCGGCGACGTGCTCATCGTCGCCCACGGCCACATCCTCCGCGCCTTTGCCCTGCGCTGGGCCGGC
AAGACTCTGCAGGAGGGTCCGACCTTTCTCCTGGAAGCCGGAGGCCTCGGCACCCTGAGGTGAGTTCTCGTCCAC
TCGACGACCTGAAGATTACAGTGGGGGGCGCTTCAGGTTCTCGGACCCAGTCCCGAGTACGGGATGGAAGCTAAC
CTTGGGGTGACGTCGCTAGCTACGAGCACCACAGTATAGAGGAGCCGGCCATTCTTCTCGGTGGCGCATTTCACG
TTGATATTGACGAGCAGGCAAATCAGCAGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail