Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|7170
Gene name
LocationContig_400:17913..18909
Strand+
Gene length (bp)996
Transcript length (bp)711
Coding sequence length (bp)711
Protein length (aa) 237

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13489 Methyltransf_23 Methyltransferase domain 1.5E-13 30 198
PF01209 Ubie_methyltran ubiE/COQ5 methyltransferase family 1.9E-11 9 163
PF13847 Methyltransf_31 Methyltransferase domain 3.8E-10 45 167
PF13649 Methyltransf_25 Methyltransferase domain 9.2E-10 50 153
PF08241 Methyltransf_11 Methyltransferase domain 4.8E-08 50 157
PF08242 Methyltransf_12 Methyltransferase domain 6.8E-08 50 155

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O94628|YGE9_SCHPO Uncharacterized methyltransferase C1347.09 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1347.09 PE=3 SV=1 1 235 2.0E-21
sp|Q8KZ94|REBMT_NOCAE Demethylrebeccamycin-D-glucose O-methyltransferase OS=Lechevalieria aerocolonigenes GN=rebM PE=1 SV=1 31 161 2.0E-08
sp|A8G8B8|UBIE_SERP5 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Serratia proteamaculans (strain 568) GN=ubiE PE=3 SV=1 12 160 2.0E-07
sp|B1KR07|UBIE_SHEWM Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Shewanella woodyi (strain ATCC 51908 / MS32) GN=ubiE PE=3 SV=1 2 160 2.0E-07
sp|Q72HI4|MENG_THET2 Demethylmenaquinone methyltransferase OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=menG PE=3 SV=1 12 170 2.0E-07
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O94628|YGE9_SCHPO Uncharacterized methyltransferase C1347.09 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1347.09 PE=3 SV=1 1 235 2.0E-21
sp|Q8KZ94|REBMT_NOCAE Demethylrebeccamycin-D-glucose O-methyltransferase OS=Lechevalieria aerocolonigenes GN=rebM PE=1 SV=1 31 161 2.0E-08
sp|A8G8B8|UBIE_SERP5 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Serratia proteamaculans (strain 568) GN=ubiE PE=3 SV=1 12 160 2.0E-07
sp|B1KR07|UBIE_SHEWM Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Shewanella woodyi (strain ATCC 51908 / MS32) GN=ubiE PE=3 SV=1 2 160 2.0E-07
sp|Q72HI4|MENG_THET2 Demethylmenaquinone methyltransferase OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=menG PE=3 SV=1 12 170 2.0E-07
sp|C5BCA4|UBIE_EDWI9 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Edwardsiella ictaluri (strain 93-146) GN=ubiE PE=3 SV=1 2 160 2.0E-07
sp|Q088H8|UBIE_SHEFN Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Shewanella frigidimarina (strain NCIMB 400) GN=ubiE PE=3 SV=1 12 160 4.0E-07
sp|A8G0S7|UBIE_SHESH Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Shewanella sediminis (strain HAW-EB3) GN=ubiE PE=3 SV=1 2 160 5.0E-07
sp|Q0HZP7|UBIE_SHESR Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Shewanella sp. (strain MR-7) GN=ubiE PE=3 SV=1 2 160 7.0E-07
sp|Q0HEA1|UBIE_SHESM Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Shewanella sp. (strain MR-4) GN=ubiE PE=3 SV=1 2 160 7.0E-07
sp|A0L1M4|UBIE_SHESA Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Shewanella sp. (strain ANA-3) GN=ubiE PE=3 SV=1 2 160 7.0E-07
sp|A1RP78|UBIE_SHESW Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Shewanella sp. (strain W3-18-1) GN=ubiE PE=3 SV=1 12 160 8.0E-07
sp|A4Y2Q5|UBIE_SHEPC Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=ubiE PE=3 SV=1 12 160 8.0E-07
sp|A1SAJ8|UBIE_SHEAM Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=ubiE PE=3 SV=1 2 160 1.0E-06
sp|B8E6B6|UBIE_SHEB2 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Shewanella baltica (strain OS223) GN=ubiE PE=3 SV=1 12 160 1.0E-06
sp|Q8E9R7|UBIE_SHEON Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Shewanella oneidensis (strain MR-1) GN=ubiE PE=3 SV=1 2 160 1.0E-06
sp|A9KYL8|UBIE_SHEB9 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Shewanella baltica (strain OS195) GN=ubiE PE=3 SV=1 12 160 2.0E-06
sp|A6WIE9|UBIE_SHEB8 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Shewanella baltica (strain OS185) GN=ubiE PE=3 SV=1 12 160 2.0E-06
sp|A3D9F2|UBIE_SHEB5 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=ubiE PE=3 SV=1 12 160 2.0E-06
sp|A3QIE1|UBIE_SHELP Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=ubiE PE=3 SV=1 12 160 3.0E-06
sp|A7MQL7|UBIE_CROS8 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=ubiE PE=3 SV=1 2 160 4.0E-06
sp|B5XYI1|UBIE_KLEP3 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Klebsiella pneumoniae (strain 342) GN=ubiE PE=3 SV=1 12 160 4.0E-06
sp|Q12S23|UBIE_SHEDO Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=ubiE PE=3 SV=1 2 160 4.0E-06
sp|P59911|UBIE_HAEDU Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=ubiE PE=3 SV=1 12 160 4.0E-06
sp|A6TGL3|UBIE_KLEP7 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=ubiE PE=3 SV=1 12 160 4.0E-06
sp|A1JIF2|UBIE_YERE8 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=ubiE PE=3 SV=1 4 160 6.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0008168 methyltransferase activity Yes
GO:0016740 transferase activity No
GO:0003674 molecular_function No
GO:0016741 transferase activity, transferring one-carbon groups No
GO:0003824 catalytic activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 45 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|7170
MADTVAANQTYFNKLASEYDTLFQEAMLIMERQLRDNIDFLGIREGGRLLDYACGTGMLSFTLGDRLSQCVGVDV
SESMVEAYNAKARSRGLSEEQCSAHVGNLIDATDASPEALSAARFGGFDGAGVGAGFHHFDDCGLAARRLAERLC
PGGVLFVLDFVAHEACSSGMSAADAAAHGVRHHGFSEVQVRELFREAGVGSNFAFRVMGKDIVFRAAGEGGRDMV
RTVFLARGEKS*
Coding >Hirsu2|7170
ATGGCTGATACCGTGGCGGCGAACCAGACTTATTTCAACAAGCTTGCCTCCGAGTATGACACCCTCTTTCAGGAG
GCGATGCTCATCATGGAGCGTCAACTGAGAGACAACATCGACTTCCTCGGGATTCGCGAGGGCGGGCGCTTGCTG
GACTACGCTTGCGGCACGGGAATGCTATCATTCACCCTGGGTGATCGTCTTAGCCAGTGCGTCGGCGTAGACGTC
TCGGAAAGCATGGTGGAGGCCTACAACGCCAAGGCACGCAGCCGGGGCCTCTCGGAAGAGCAGTGCAGCGCACAC
GTCGGCAACCTGATCGATGCCACCGACGCCTCGCCCGAGGCCCTTTCGGCGGCGCGCTTCGGCGGCTTCGACGGC
GCCGGCGTCGGCGCGGGCTTCCACCACTTCGACGATTGCGGCCTCGCGGCGCGGCGCCTCGCGGAGCGGCTGTGC
CCCGGCGGCGTCCTCTTTGTCCTCGACTTCGTCGCGCACGAGGCCTGCTCATCCGGCATGAGCGCCGCCGACGCG
GCAGCCCACGGGGTTCGCCATCACGGCTTCTCCGAGGTCCAGGTGCGGGAACTCTTCCGGGAGGCCGGCGTGGGA
TCCAACTTCGCCTTCCGCGTCATGGGGAAGGACATCGTATTCAGGGCGGCCGGCGAGGGCGGGCGGGACATGGTC
AGGACAGTGTTCCTGGCCCGCGGCGAAAAATCCTAG
Transcript >Hirsu2|7170
ATGGCTGATACCGTGGCGGCGAACCAGACTTATTTCAACAAGCTTGCCTCCGAGTATGACACCCTCTTTCAGGAG
GCGATGCTCATCATGGAGCGTCAACTGAGAGACAACATCGACTTCCTCGGGATTCGCGAGGGCGGGCGCTTGCTG
GACTACGCTTGCGGCACGGGAATGCTATCATTCACCCTGGGTGATCGTCTTAGCCAGTGCGTCGGCGTAGACGTC
TCGGAAAGCATGGTGGAGGCCTACAACGCCAAGGCACGCAGCCGGGGCCTCTCGGAAGAGCAGTGCAGCGCACAC
GTCGGCAACCTGATCGATGCCACCGACGCCTCGCCCGAGGCCCTTTCGGCGGCGCGCTTCGGCGGCTTCGACGGC
GCCGGCGTCGGCGCGGGCTTCCACCACTTCGACGATTGCGGCCTCGCGGCGCGGCGCCTCGCGGAGCGGCTGTGC
CCCGGCGGCGTCCTCTTTGTCCTCGACTTCGTCGCGCACGAGGCCTGCTCATCCGGCATGAGCGCCGCCGACGCG
GCAGCCCACGGGGTTCGCCATCACGGCTTCTCCGAGGTCCAGGTGCGGGAACTCTTCCGGGAGGCCGGCGTGGGA
TCCAACTTCGCCTTCCGCGTCATGGGGAAGGACATCGTATTCAGGGCGGCCGGCGAGGGCGGGCGGGACATGGTC
AGGACAGTGTTCCTGGCCCGCGGCGAAAAATCCTAG
Gene >Hirsu2|7170
ATGGCTGATACCGTGGCGGCGAACCAGACTTATTTCAAGTACGTCAGATATTTCCTCCGGCCAAAGTGGCCCCCA
CGCTCACACCGTCCGTTTACAGCAAGCTTGCCTCCGAGTATGACACCCTCTTTCAGGAGGCGATGCTCATCATGG
AGCGTCAACTGAGAGACAACATCGACTTCCTCGGGATTCGCGAGGGCGGGCGCTTGCTGGACTACGCTTGCGGCA
CGGGAATGCTATCATTCGTAAGTAGCGTTCAATGCCCAACCTGAGGGAAGGTGGCGAGCGTTATCTTGCCACGGG
CTGACCAGGCACGAACAGACCCTGGGTGATCGTCTTAGCCAGTGCGTCGGCGTAGACGTCTCGGAAAGCATGGTG
GAGGCCTACAACGCCAAGGCACGCAGCCGGGTAAGACAGCGCTTTGATTTCCTCGACTCCAGTCAATTCTTTCGG
CTTTCCTTCGTCCATTTCCTCAAGCAACTACTGCACCGAGCACGACAAGACTGCCGATCTGACACAAGATCAAAC
CGCTGACTGACCGACTCTCTCTGGGACCAGGGCCTCTCGGAAGAGCAGTGCAGCGCACACGTCGGCAACCTGATC
GATGCCACCGACGCCTCGCCCGAGGCCCTTTCGGCGGCGCGCTTCGGCGGCTTCGACGGCGCCGGCGTCGGCGCG
GGCTTCCACCACTTCGACGATTGCGGCCTCGCGGCGCGGCGCCTCGCGGAGCGGCTGTGCCCCGGCGGCGTCCTC
TTTGTCCTCGACTTCGTCGCGCACGAGGCCTGCTCATCCGGCATGAGCGCCGCCGACGCGGCAGCCCACGGGGTT
CGCCATCACGGCTTCTCCGAGGTCCAGGTGCGGGAACTCTTCCGGGAGGCCGGCGTGGGATCCAACTTCGCCTTC
CGCGTCATGGGGAAGGACATCGTATTCAGGGCGGCCGGCGAGGGCGGGCGGGACATGGTCAGGACAGTGTTCCTG
GCCCGCGGCGAAAAATCCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail