Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|7167
Gene name
LocationContig_400:8625..9719
Strand-
Gene length (bp)1094
Transcript length (bp)1017
Coding sequence length (bp)1017
Protein length (aa) 339

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00445 Ribonuclease_T2 Ribonuclease T2 family 2.1E-11 188 297

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P24657|RNTR_HYPRU Ribonuclease Trv OS=Hypocrea rufa PE=1 SV=1 195 327 3.0E-14
sp|Q5B3K6|RNY1_EMENI Ribonuclease T2-like OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=rny1 PE=3 SV=1 202 323 6.0E-11
sp|P10281|RNT2_ASPOR Ribonuclease T2 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=rntB PE=1 SV=2 195 330 2.0E-10
sp|P19791|RNM_ASPPH Ribonuclease M OS=Aspergillus phoenicis PE=1 SV=1 198 301 4.0E-10
sp|Q4WXZ5|RNY1_ASPFU Ribonuclease T2-like OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=rny1 PE=3 SV=2 195 330 2.0E-09
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P24657|RNTR_HYPRU Ribonuclease Trv OS=Hypocrea rufa PE=1 SV=1 195 327 3.0E-14
sp|Q5B3K6|RNY1_EMENI Ribonuclease T2-like OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=rny1 PE=3 SV=1 202 323 6.0E-11
sp|P10281|RNT2_ASPOR Ribonuclease T2 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=rntB PE=1 SV=2 195 330 2.0E-10
sp|P19791|RNM_ASPPH Ribonuclease M OS=Aspergillus phoenicis PE=1 SV=1 198 301 4.0E-10
sp|Q4WXZ5|RNY1_ASPFU Ribonuclease T2-like OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=rny1 PE=3 SV=2 195 330 2.0E-09
sp|P08056|RNRH_RHINI Ribonuclease Rh OS=Rhizopus niveus PE=1 SV=1 195 330 6.0E-07
sp|Q6CAV7|RNY1_YARLI Ribonuclease T2-like OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=RNY1 PE=3 SV=1 195 327 2.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0003723 RNA binding Yes
GO:0033897 ribonuclease T2 activity Yes
GO:0016849 phosphorus-oxygen lyase activity No
GO:0003674 molecular_function No
GO:0140098 catalytic activity, acting on RNA No
GO:0003676 nucleic acid binding No
GO:0016787 hydrolase activity No
GO:0004518 nuclease activity No
GO:0004521 endoribonuclease activity No
GO:0016788 hydrolase activity, acting on ester bonds No
GO:0004519 endonuclease activity No
GO:1901363 heterocyclic compound binding No
GO:0005488 binding No
GO:0016829 lyase activity No
GO:0003824 catalytic activity No
GO:0097159 organic cyclic compound binding No
GO:0004540 ribonuclease activity No
GO:0140640 catalytic activity, acting on a nucleic acid No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 20 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|7167
MMLLRALTPVIGFASLAQADTVHLRRNQTATSASKHIDVCNPQKEGHGRMVFTERWEPDSHSWVSERLWHAKSGG
SAPEEYCDKSRAYKNITAIIFYNNVKEMIRPWNRPFFLNETQYQDLLGNIKRVINDLNATELLAANVSADIFAKV
EYEKLFNKDNFEFARAMIDLYDPNAPIHVPVESLDTLKSQFGTAGGVERFMEEAWARDGTCVPALSLDCYENYAD
FEYGQEVVAYVERLATTSHQTYEKLEDAGIVPSEEKTYAMTKIEKAIKGNLAYARPTFVCESDVLIAIRYYYKVE
GHFDQSVFETADPESEESKACPANVRYLSRINAPTERL*
Coding >Hirsu2|7167
ATGATGCTGCTCCGCGCCTTGACACCTGTCATAGGCTTTGCCTCTCTCGCCCAGGCGGACACAGTTCACCTTCGC
AGAAACCAGACGGCCACGAGCGCGTCTAAGCATATCGATGTCTGCAACCCGCAAAAAGAGGGCCATGGGCGTATG
GTCTTCACGGAGCGTTGGGAGCCGGATTCCCACTCGTGGGTCAGCGAACGTCTCTGGCATGCTAAAAGCGGCGGC
TCGGCGCCCGAGGAATACTGCGATAAGAGCAGGGCATACAAAAATATCACGGCCATTATCTTCTACAACAACGTT
AAGGAAATGATACGTCCCTGGAACCGTCCCTTTTTTCTTAACGAGACCCAGTACCAGGATCTGCTAGGCAATATC
AAGCGCGTGATCAACGACCTCAATGCCACGGAACTGCTAGCCGCTAACGTTTCCGCCGACATCTTTGCCAAAGTT
GAGTATGAGAAGCTATTTAACAAGGATAACTTTGAGTTCGCCAGAGCCATGATCGACCTGTACGACCCGAACGCC
CCGATTCATGTTCCTGTTGAGTCGCTGGACACGCTCAAGAGCCAGTTCGGGACTGCCGGTGGCGTCGAGCGCTTT
ATGGAGGAGGCCTGGGCCAGAGATGGCACCTGCGTCCCCGCACTCAGCCTGGACTGCTATGAGAACTATGCCGAT
TTCGAGTACGGCCAGGAAGTCGTGGCCTACGTTGAACGGTTGGCTACCACTAGCCATCAGACATACGAGAAGCTC
GAAGATGCGGGAATCGTGCCGTCCGAGGAAAAGACGTATGCCATGACGAAAATCGAGAAAGCCATCAAGGGCAAC
TTAGCCTATGCTAGGCCTACGTTTGTCTGCGAAAGTGACGTTCTTATCGCGATCAGATACTACTATAAGGTCGAG
GGGCATTTCGACCAAAGTGTCTTTGAGACTGCTGATCCTGAGTCGGAGGAGTCCAAGGCTTGCCCCGCGAATGTC
CGGTACCTGTCAAGGATCAATGCCCCGACTGAAAGACTTTAG
Transcript >Hirsu2|7167
ATGATGCTGCTCCGCGCCTTGACACCTGTCATAGGCTTTGCCTCTCTCGCCCAGGCGGACACAGTTCACCTTCGC
AGAAACCAGACGGCCACGAGCGCGTCTAAGCATATCGATGTCTGCAACCCGCAAAAAGAGGGCCATGGGCGTATG
GTCTTCACGGAGCGTTGGGAGCCGGATTCCCACTCGTGGGTCAGCGAACGTCTCTGGCATGCTAAAAGCGGCGGC
TCGGCGCCCGAGGAATACTGCGATAAGAGCAGGGCATACAAAAATATCACGGCCATTATCTTCTACAACAACGTT
AAGGAAATGATACGTCCCTGGAACCGTCCCTTTTTTCTTAACGAGACCCAGTACCAGGATCTGCTAGGCAATATC
AAGCGCGTGATCAACGACCTCAATGCCACGGAACTGCTAGCCGCTAACGTTTCCGCCGACATCTTTGCCAAAGTT
GAGTATGAGAAGCTATTTAACAAGGATAACTTTGAGTTCGCCAGAGCCATGATCGACCTGTACGACCCGAACGCC
CCGATTCATGTTCCTGTTGAGTCGCTGGACACGCTCAAGAGCCAGTTCGGGACTGCCGGTGGCGTCGAGCGCTTT
ATGGAGGAGGCCTGGGCCAGAGATGGCACCTGCGTCCCCGCACTCAGCCTGGACTGCTATGAGAACTATGCCGAT
TTCGAGTACGGCCAGGAAGTCGTGGCCTACGTTGAACGGTTGGCTACCACTAGCCATCAGACATACGAGAAGCTC
GAAGATGCGGGAATCGTGCCGTCCGAGGAAAAGACGTATGCCATGACGAAAATCGAGAAAGCCATCAAGGGCAAC
TTAGCCTATGCTAGGCCTACGTTTGTCTGCGAAAGTGACGTTCTTATCGCGATCAGATACTACTATAAGGTCGAG
GGGCATTTCGACCAAAGTGTCTTTGAGACTGCTGATCCTGAGTCGGAGGAGTCCAAGGCTTGCCCCGCGAATGTC
CGGTACCTGTCAAGGATCAATGCCCCGACTGAAAGACTTTAG
Gene >Hirsu2|7167
ATGATGCTGCTCCGCGCCTTGACACCTGTCATAGGCTTTGCCTCTCTCGCCCAGGCGGACACAGTTCACCTTCGC
AGAAACCAGACGGCCACGAGCGCGTCTAAGCATATCGATGTCTGCAACCCGCAAAAAGAGGGCCATGGGCGTATG
GTCTTCACGGAGCGTTGGGAGCCGGATTCCCGTAAGTCAGCAAGCTTTCGCCACGCGAAGCAGGCTTCCAAGACA
GCTCTAAAGCTCACACACAACATGTTCACAAAGACTCGTGGGTCAGCGAACGTCTCTGGCATGCTAAAAGCGGCG
GCTCGGCGCCCGAGGAATACTGCGATAAGAGCAGGGCATACAAAAATATCACGGCCATTATCTTCTACAACAACG
TTAAGGAAATGATACGTCCCTGGAACCGTCCCTTTTTTCTTAACGAGACCCAGTACCAGGATCTGCTAGGCAATA
TCAAGCGCGTGATCAACGACCTCAATGCCACGGAACTGCTAGCCGCTAACGTTTCCGCCGACATCTTTGCCAAAG
TTGAGTATGAGAAGCTATTTAACAAGGATAACTTTGAGTTCGCCAGAGCCATGATCGACCTGTACGACCCGAACG
CCCCGATTCATGTTCCTGTTGAGTCGCTGGACACGCTCAAGAGCCAGTTCGGGACTGCCGGTGGCGTCGAGCGCT
TTATGGAGGAGGCCTGGGCCAGAGATGGCACCTGCGTCCCCGCACTCAGCCTGGACTGCTATGAGAACTATGCCG
ATTTCGAGTACGGCCAGGAAGTCGTGGCCTACGTTGAACGGTTGGCTACCACTAGCCATCAGACATACGAGAAGC
TCGAAGATGCGGGAATCGTGCCGTCCGAGGAAAAGACGTATGCCATGACGAAAATCGAGAAAGCCATCAAGGGCA
ACTTAGCCTATGCTAGGCCTACGTTTGTCTGCGAAAGTGACGTTCTTATCGCGATCAGATACTACTATAAGGTCG
AGGGGCATTTCGACCAAAGTGTCTTTGAGACTGCTGATCCTGAGTCGGAGGAGTCCAAGGCTTGCCCCGCGAATG
TCCGGTACCTGTCAAGGATCAATGCCCCGACTGAAAGACTTTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail