Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|7163
Gene name
LocationContig_40:53047..54778
Strand+
Gene length (bp)1731
Transcript length (bp)1521
Coding sequence length (bp)1521
Protein length (aa) 507

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02133 Transp_cyt_pur Permease for cytosine/purines, uracil, thiamine, allantoin 1.0E-31 60 433

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|C8V329|FCY2_EMENI Purine-cytosine permease fcyB OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=fcyB PE=1 SV=1 4 506 2.0E-79
sp|Q12119|FCY22_YEAST Purine-cytosine permease FCY22 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FCY22 PE=3 SV=1 13 506 6.0E-70
sp|P17064|FCY2_YEAST Purine-cytosine permease FCY2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FCY2 PE=1 SV=2 9 506 9.0E-69
sp|P40039|FCY21_YEAST Purine-cytosine permease FCY21 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FCY21 PE=1 SV=2 1 506 6.0E-65
sp|P53099|TPN1_YEAST Vitamin B6 transporter TPN1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPN1 PE=1 SV=1 2 506 4.0E-43
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|C8V329|FCY2_EMENI Purine-cytosine permease fcyB OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=fcyB PE=1 SV=1 4 506 2.0E-79
sp|Q12119|FCY22_YEAST Purine-cytosine permease FCY22 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FCY22 PE=3 SV=1 13 506 6.0E-70
sp|P17064|FCY2_YEAST Purine-cytosine permease FCY2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FCY2 PE=1 SV=2 9 506 9.0E-69
sp|P40039|FCY21_YEAST Purine-cytosine permease FCY21 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FCY21 PE=1 SV=2 1 506 6.0E-65
sp|P53099|TPN1_YEAST Vitamin B6 transporter TPN1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPN1 PE=1 SV=1 2 506 4.0E-43
sp|Q874L4|TPN1_YEASX Vitamin B6 transporter TPN1 OS=Saccharomyces cerevisiae GN=TPN1 PE=3 SV=1 2 506 5.0E-43
sp|P94369|YXLA_BACSU Putative purine-cytosine permease YxlA OS=Bacillus subtilis (strain 168) GN=yxlA PE=3 SV=1 51 506 4.0E-18
[Show less]

GO

GO Term Description Terminal node
GO:0055085 transmembrane transport Yes
GO:0022857 transmembrane transporter activity Yes
GO:0016020 membrane Yes
GO:0008150 biological_process No
GO:0006810 transport No
GO:0051234 establishment of localization No
GO:0003674 molecular_function No
GO:0051179 localization No
GO:0005575 cellular_component No
GO:0005215 transporter activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 13 0.45

Transmembrane Domains

Domain # Start End Length
1 73 95 22
2 105 127 22
3 148 170 22
4 185 207 22
5 209 231 22
6 284 306 22
7 319 341 22
8 346 368 22
9 375 397 22
10 402 424 22
11 443 465 22
12 480 499 19

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|7163
MDREAEAAKEPRLQATTAISSCHSNGLSDNSDSTVGDSGSGLLHRLLRAGRVEQAGIRPLPEEERRNVRFFNIFT
IWFSINSNILGITFGMLGPAVYGLSLRDSALVILFFGLLSTLAPAFLAVLGPKTGMRQMIQARYSFGRYFVTVPV
LLNLATLTGFTVIICVVGGQCLSAVSEGSLSPSVGIVIIALSSLLVSFAGFSVLHLFETYAFIAALISIAIAAGV
GGSGLAKQAQPARAPQARQLLNFGMVVASYQIPWAAISSDLTTYFDPRVPSWRVFHYTYWGLLIPTVLLMTLGAA
VAGAIPNNPDWQHGYERYLVGGALAGMLSSAGGFGKFVLVVLSLTLLGNTCGTFYAITLNFQTVVPWLARVPRYV
FSIVVTAIVIPVAIESVGNFFVNLENLIALIGYWSAAFVGIVVTEHLVFRRGRYETYDHAIWDTASKLPVGAAAL
AASVACFGLVVPFMDQIWWTGPVARTSGDIGFEMAFALSSLLYVPLRYVEKRLSGR*
Coding >Hirsu2|7163
ATGGATCGCGAGGCCGAGGCCGCCAAGGAGCCGCGGCTCCAGGCCACGACGGCCATCAGCAGCTGCCACAGCAAC
GGCCTCAGCGACAACAGCGACAGCACCGTTGGCGACAGCGGCTCGGGGCTGCTACACAGATTGCTCCGTGCCGGT
CGCGTCGAACAGGCCGGAATCCGCCCGCTGCCGGAGGAAGAGCGCCGCAATGTGCGCTTCTTCAACATCTTCACC
ATCTGGTTCTCCATCAACTCCAACATCCTGGGCATCACCTTCGGCATGCTGGGACCGGCGGTGTACGGCCTGAGC
CTCCGCGACTCGGCCCTCGTCATCCTCTTCTTCGGCCTCCTCTCCACCCTGGCCCCGGCCTTCCTCGCCGTTCTT
GGCCCCAAGACGGGCATGCGGCAGATGATCCAGGCGCGATATAGCTTCGGGCGCTATTTCGTCACCGTCCCTGTC
CTGTTGAACCTTGCCACCTTGACCGGCTTCACCGTCATCATTTGCGTCGTCGGTGGCCAGTGTCTCTCGGCCGTC
TCCGAGGGTAGTCTGTCGCCCAGTGTCGGCATCGTCATCATCGCCCTCTCGTCTCTGCTCGTCTCTTTTGCCGGC
TTCTCCGTCCTGCACCTGTTCGAGACGTACGCTTTCATTGCCGCTCTCATCAGCATCGCCATCGCTGCCGGCGTC
GGCGGCTCCGGTCTTGCCAAGCAGGCGCAGCCGGCGCGGGCTCCCCAGGCCCGTCAACTTCTCAACTTTGGCATG
GTCGTCGCCAGCTACCAGATCCCCTGGGCTGCCATTTCCAGCGATCTCACGACCTACTTTGACCCCAGGGTCCCA
TCCTGGCGCGTCTTTCACTACACGTACTGGGGCCTCCTCATCCCCACCGTGCTGCTCATGACGCTTGGTGCCGCT
GTGGCTGGGGCCATCCCCAACAACCCGGACTGGCAGCACGGGTACGAGCGGTACCTCGTCGGCGGCGCCCTGGCC
GGCATGCTGTCGAGCGCGGGCGGCTTCGGCAAGTTCGTCCTGGTGGTGCTGTCGCTGACGCTGCTGGGCAACACG
TGCGGCACCTTTTACGCCATCACGCTCAACTTCCAGACGGTGGTGCCGTGGCTGGCGCGGGTGCCGCGCTACGTC
TTCTCCATCGTCGTCACGGCCATTGTCATCCCCGTCGCCATCGAGTCGGTCGGCAACTTCTTTGTTAACCTCGAG
AACCTGATCGCGCTCATCGGCTACTGGTCCGCGGCCTTTGTCGGCATCGTGGTGACGGAGCACCTCGTCTTCCGC
CGCGGCCGCTACGAGACGTACGACCATGCCATCTGGGACACGGCGAGCAAGCTGCCCGTGGGCGCGGCGGCGCTG
GCCGCGAGCGTCGCCTGCTTCGGTCTGGTGGTGCCCTTCATGGACCAGATCTGGTGGACGGGGCCCGTTGCGCGG
ACGTCGGGCGACATTGGCTTCGAGATGGCCTTTGCCCTGAGCTCGTTACTCTACGTGCCGCTGCGCTACGTCGAG
AAGCGGCTCAGTGGGCGCTAG
Transcript >Hirsu2|7163
ATGGATCGCGAGGCCGAGGCCGCCAAGGAGCCGCGGCTCCAGGCCACGACGGCCATCAGCAGCTGCCACAGCAAC
GGCCTCAGCGACAACAGCGACAGCACCGTTGGCGACAGCGGCTCGGGGCTGCTACACAGATTGCTCCGTGCCGGT
CGCGTCGAACAGGCCGGAATCCGCCCGCTGCCGGAGGAAGAGCGCCGCAATGTGCGCTTCTTCAACATCTTCACC
ATCTGGTTCTCCATCAACTCCAACATCCTGGGCATCACCTTCGGCATGCTGGGACCGGCGGTGTACGGCCTGAGC
CTCCGCGACTCGGCCCTCGTCATCCTCTTCTTCGGCCTCCTCTCCACCCTGGCCCCGGCCTTCCTCGCCGTTCTT
GGCCCCAAGACGGGCATGCGGCAGATGATCCAGGCGCGATATAGCTTCGGGCGCTATTTCGTCACCGTCCCTGTC
CTGTTGAACCTTGCCACCTTGACCGGCTTCACCGTCATCATTTGCGTCGTCGGTGGCCAGTGTCTCTCGGCCGTC
TCCGAGGGTAGTCTGTCGCCCAGTGTCGGCATCGTCATCATCGCCCTCTCGTCTCTGCTCGTCTCTTTTGCCGGC
TTCTCCGTCCTGCACCTGTTCGAGACGTACGCTTTCATTGCCGCTCTCATCAGCATCGCCATCGCTGCCGGCGTC
GGCGGCTCCGGTCTTGCCAAGCAGGCGCAGCCGGCGCGGGCTCCCCAGGCCCGTCAACTTCTCAACTTTGGCATG
GTCGTCGCCAGCTACCAGATCCCCTGGGCTGCCATTTCCAGCGATCTCACGACCTACTTTGACCCCAGGGTCCCA
TCCTGGCGCGTCTTTCACTACACGTACTGGGGCCTCCTCATCCCCACCGTGCTGCTCATGACGCTTGGTGCCGCT
GTGGCTGGGGCCATCCCCAACAACCCGGACTGGCAGCACGGGTACGAGCGGTACCTCGTCGGCGGCGCCCTGGCC
GGCATGCTGTCGAGCGCGGGCGGCTTCGGCAAGTTCGTCCTGGTGGTGCTGTCGCTGACGCTGCTGGGCAACACG
TGCGGCACCTTTTACGCCATCACGCTCAACTTCCAGACGGTGGTGCCGTGGCTGGCGCGGGTGCCGCGCTACGTC
TTCTCCATCGTCGTCACGGCCATTGTCATCCCCGTCGCCATCGAGTCGGTCGGCAACTTCTTTGTTAACCTCGAG
AACCTGATCGCGCTCATCGGCTACTGGTCCGCGGCCTTTGTCGGCATCGTGGTGACGGAGCACCTCGTCTTCCGC
CGCGGCCGCTACGAGACGTACGACCATGCCATCTGGGACACGGCGAGCAAGCTGCCCGTGGGCGCGGCGGCGCTG
GCCGCGAGCGTCGCCTGCTTCGGTCTGGTGGTGCCCTTCATGGACCAGATCTGGTGGACGGGGCCCGTTGCGCGG
ACGTCGGGCGACATTGGCTTCGAGATGGCCTTTGCCCTGAGCTCGTTACTCTACGTGCCGCTGCGCTACGTCGAG
AAGCGGCTCAGTGGGCGCTAG
Gene >Hirsu2|7163
ATGGATCGCGAGGCCGAGGCCGCCAAGGAGCCGCGGCTCCAGGCCACGACGGCCATCAGCAGCTGCCACAGCAAC
GGCCTCAGCGACAACAGCGACAGCACCGTTGGCGACAGCGGCTCGGGGCTGCTACACAGATTGCTCCGTGCCGGT
CGCGTCGAACAGGCCGGAATCCGCCCGCTGCCGGAGGAAGAGCGCCGCAATGTGCGCTTCTTCAACATCTTCACC
ATCTGGTTCTCCATCAACTCCAACATCCTGGGGTGCGTCTGCCTCCCCCCCAACCCCTTGCCCGCTTGCGTGTAC
CGCTGCTAAGCCCTTGATTTTTCTTCCGGTAGCATCACCTTCGGCATGCTGGGACCGGCGGTGTACGGCCTGAGC
CTCCGCGACTCGGCCCTCGTCATCCTCTTCTTCGGCCTCCTCTCCACCCTGGCCCCGGCCTTCCTCGCCGTTCTT
GGCCCCAAGACGGGCATGCGGCAGATGATCCAGGCGCGATATAGCTTCGGGTACGCATCTCGCACCCCTCACTGA
CACCTGCTTGGCCTGCTTCCTCGCCGCTCTGACACGCCCACGCTCATGCCGCCAGGCGCTATTTCGTCACCGTCC
CTGTCCTGTTGAACCTTGCCACCTTGACCGGCTTCACCGTCATCATTTGCGTCGTCGGTGGCCAGTGTCTCTCGG
CCGTCTCCGAGGGTAGTCTGTCGCCCAGTGTCGGCATCGTCATCATCGCCCTCTCGTCTCTGCTCGTCTCTTTTG
CCGGCTTCTCCGTCCTGCACCTGTTCGAGACGTACGCTTTCATTGCCGCTCTCATCAGCATCGCCATCGCTGCCG
GCGTCGGCGGCTCCGGTCTTGCCAAGCAGGCGCAGCCGGCGCGGGCTCCCCAGGCCCGTCAACTTCTCAACTTTG
GCATGGTCGTCGCCAGCTACCAGATCCCCTGGGCTGCCATTTCCAGCGATCTCACGACCTACTTTGACCCCAGGG
TCCCATCGTGAGTTGCGCCCGATGCCGGTGAGCTCCGTCTCGACTGACTGGTGTCTGTTTAGCTGGCGCGTCTTT
CACTACACGTACTGGGGCCTCCTCATCCCCACCGTGCTGCTCATGACGCTTGGTGCCGCTGTGGCTGGGGCCATC
CCCAACAACCCGGACTGGCAGCACGGGTACGAGCGGTACCTCGTCGGCGGCGCCCTGGCCGGCATGCTGTCGAGC
GCGGGCGGCTTCGGCAAGTTCGTCCTGGTGGTGCTGTCGCTGACGCTGCTGGGCAACACGTGCGGCACCTTTTAC
GCCATCACGCTCAACTTCCAGACGGTGGTGCCGTGGCTGGCGCGGGTGCCGCGCTACGTCTTCTCCATCGTCGTC
ACGGCCATTGTCATCCCCGTCGCCATCGAGTCGGTCGGCAACTTCTTTGTTAACCTCGAGAACCTGATCGCGCTC
ATCGGCTACTGGTCCGCGGCCTTTGTCGGCATCGTGGTGACGGAGCACCTCGTCTTCCGCCGCGGCCGCTACGAG
ACGTACGACCATGCCATCTGGGACACGGCGAGCAAGCTGCCCGTGGGCGCGGCGGCGCTGGCCGCGAGCGTCGCC
TGCTTCGGTCTGGTGGTGCCCTTCATGGACCAGATCTGGTGGACGGGGCCCGTTGCGCGGACGTCGGGCGACATT
GGCTTCGAGATGGCCTTTGCCCTGAGCTCGTTACTCTACGTGCCGCTGCGCTACGTCGAGAAGCGGCTCAGTGGG
CGCTAG

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail