Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|7159
Gene name
LocationContig_40:42692..44370
Strand+
Gene length (bp)1678
Transcript length (bp)1620
Coding sequence length (bp)1620
Protein length (aa) 540

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00069 Pkinase Protein kinase domain 2.1E-37 212 518
PF07714 Pkinase_Tyr Protein tyrosine kinase 2.4E-08 213 330

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P50582|HSK1_SCHPO Cell cycle serine/threonine-protein kinase hsk1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=hsk1 PE=1 SV=1 104 535 1.0E-132
sp|Q9UQY9|SPO4_SCHPO Cell cycle protein kinase spo4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=spo4 PE=1 SV=1 139 521 2.0E-98
sp|P06243|CDC7_YEAST Cell division control protein 7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CDC7 PE=1 SV=2 125 457 1.0E-80
sp|Q8SR83|CDC72_ENCCU Probable cell division control protein 7 homolog 2 OS=Encephalitozoon cuniculi (strain GB-M1) GN=CDC7-2 PE=3 SV=1 133 518 1.0E-75
sp|Q8SR85|CDC71_ENCCU Probable cell division control protein 7 homolog 1 OS=Encephalitozoon cuniculi (strain GB-M1) GN=CDC7-1 PE=3 SV=1 133 518 2.0E-75
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P50582|HSK1_SCHPO Cell cycle serine/threonine-protein kinase hsk1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=hsk1 PE=1 SV=1 104 535 1.0E-132
sp|Q9UQY9|SPO4_SCHPO Cell cycle protein kinase spo4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=spo4 PE=1 SV=1 139 521 2.0E-98
sp|P06243|CDC7_YEAST Cell division control protein 7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CDC7 PE=1 SV=2 125 457 1.0E-80
sp|Q8SR83|CDC72_ENCCU Probable cell division control protein 7 homolog 2 OS=Encephalitozoon cuniculi (strain GB-M1) GN=CDC7-2 PE=3 SV=1 133 518 1.0E-75
sp|Q8SR85|CDC71_ENCCU Probable cell division control protein 7 homolog 1 OS=Encephalitozoon cuniculi (strain GB-M1) GN=CDC7-1 PE=3 SV=1 133 518 2.0E-75
sp|Q54DK3|CDC7_DICDI Probable serine/threonine-protein kinase cdc7 OS=Dictyostelium discoideum GN=cdc7 PE=3 SV=1 145 329 3.0E-27
sp|Q54DK3|CDC7_DICDI Probable serine/threonine-protein kinase cdc7 OS=Dictyostelium discoideum GN=cdc7 PE=3 SV=1 369 518 3.0E-26
sp|P19454|CSK22_YEAST Casein kinase II subunit alpha' OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CKA2 PE=1 SV=2 154 520 7.0E-25
sp|P40231|CSK2A_SCHPO Casein kinase II subunit alpha OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cka1 PE=2 SV=2 139 520 6.0E-22
sp|O00311|CDC7_HUMAN Cell division cycle 7-related protein kinase OS=Homo sapiens GN=CDC7 PE=1 SV=1 134 329 7.0E-21
sp|Q02720|CSK2A_DICDI Casein kinase II subunit alpha OS=Dictyostelium discoideum GN=casK PE=2 SV=1 236 519 8.0E-21
sp|Q4U925|CSK2A_THEAN Casein kinase II subunit alpha OS=Theileria annulata GN=TA10630 PE=3 SV=2 236 518 1.0E-20
sp|Q9Z0H0|CDC7_MOUSE Cell division cycle 7-related protein kinase OS=Mus musculus GN=Cdc7 PE=1 SV=2 121 329 4.0E-20
sp|P28547|CSK2A_THEPA Casein kinase II subunit alpha OS=Theileria parva GN=TP04_0659 PE=3 SV=2 236 518 4.0E-20
sp|Q54LR6|Y6481_DICDI Probable serine/threonine-protein kinase DDB_G0286481 OS=Dictyostelium discoideum GN=DDB_G0286481 PE=3 SV=1 131 519 2.0E-19
sp|Q63699|CDK2_RAT Cyclin-dependent kinase 2 OS=Rattus norvegicus GN=Cdk2 PE=1 SV=1 152 524 8.0E-19
sp|O55076|CDK2_CRIGR Cyclin-dependent kinase 2 OS=Cricetulus griseus GN=CDK2 PE=2 SV=1 152 524 1.0E-18
sp|Q40531|NTF6_TOBAC Mitogen-activated protein kinase homolog NTF6 OS=Nicotiana tabacum GN=NTF6 PE=2 SV=1 285 518 1.0E-18
sp|Q5E9Y0|CDK2_BOVIN Cyclin-dependent kinase 2 OS=Bos taurus GN=CDK2 PE=2 SV=1 152 524 1.0E-18
sp|Q96WV9|CDK9_SCHPO Probable cyclin-dependent kinase 9 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cdk9 PE=1 SV=1 154 525 1.0E-18
sp|O00311|CDC7_HUMAN Cell division cycle 7-related protein kinase OS=Homo sapiens GN=CDC7 PE=1 SV=1 353 451 2.0E-18
sp|Q84TI6|CDKE1_ARATH Cyclin-dependent kinase E-1 OS=Arabidopsis thaliana GN=CDKE-1 PE=1 SV=2 148 527 2.0E-18
sp|P19784|CSK22_HUMAN Casein kinase II subunit alpha' OS=Homo sapiens GN=CSNK2A2 PE=1 SV=1 236 518 2.0E-18
sp|Q9Z0H0|CDC7_MOUSE Cell division cycle 7-related protein kinase OS=Mus musculus GN=Cdc7 PE=1 SV=2 372 451 3.0E-18
sp|Q08467|CSK21_ARATH Casein kinase II subunit alpha-1 OS=Arabidopsis thaliana GN=CKA1 PE=1 SV=3 236 522 4.0E-18
sp|P24941|CDK2_HUMAN Cyclin-dependent kinase 2 OS=Homo sapiens GN=CDK2 PE=1 SV=2 152 524 4.0E-18
sp|Q336X9|MPK6_ORYSJ Mitogen-activated protein kinase 6 OS=Oryza sativa subsp. japonica GN=MPK6 PE=2 SV=1 285 518 4.0E-18
sp|Q9C9U2|CDKD1_ARATH Cyclin-dependent kinase D-1 OS=Arabidopsis thaliana GN=CDKD-1 PE=1 SV=1 155 524 6.0E-18
sp|Q9LMT0|CDKD3_ARATH Cyclin-dependent kinase D-3 OS=Arabidopsis thaliana GN=CDKD-3 PE=1 SV=1 152 524 6.0E-18
sp|P48963|CDK2_MESAU Cyclin-dependent kinase 2 OS=Mesocricetus auratus GN=CDK2 PE=2 SV=1 152 524 7.0E-18
sp|Q08466|CSK22_ARATH Casein kinase II subunit alpha-2 OS=Arabidopsis thaliana GN=CKA2 PE=2 SV=3 236 522 7.0E-18
sp|P20427|CSK22_BOVIN Casein kinase II subunit alpha' OS=Bos taurus GN=CSNK2A2 PE=1 SV=3 236 518 1.0E-17
sp|O54833|CSK22_MOUSE Casein kinase II subunit alpha' OS=Mus musculus GN=Csnk2a2 PE=1 SV=1 236 518 1.0E-17
sp|P28523|CSK2A_MAIZE Casein kinase II subunit alpha OS=Zea mays GN=ACK2 PE=1 SV=1 236 522 1.0E-17
sp|P21869|CSK22_CHICK Casein kinase II subunit alpha' OS=Gallus gallus PE=2 SV=1 236 518 2.0E-17
sp|Q54Y06|Y8487_DICDI Probable cyclin-dependent serine/threonine-protein kinase DDB_G0278487 OS=Dictyostelium discoideum GN=DDB_G0278487 PE=2 SV=1 136 524 3.0E-17
sp|P0C865|MK07_RAT Mitogen-activated protein kinase 7 OS=Rattus norvegicus GN=Mapk7 PE=1 SV=1 215 518 5.0E-17
sp|Q9LMM5|MPK11_ARATH Mitogen-activated protein kinase 11 OS=Arabidopsis thaliana GN=MPK11 PE=1 SV=1 284 518 5.0E-17
sp|Q9WVS8|MK07_MOUSE Mitogen-activated protein kinase 7 OS=Mus musculus GN=Mapk7 PE=1 SV=1 215 518 5.0E-17
sp|P43450|CDK2_CARAU Cyclin-dependent kinase 2 OS=Carassius auratus GN=cdk2 PE=2 SV=1 152 524 6.0E-17
sp|P23437|CDK2_XENLA Cyclin-dependent kinase 2 OS=Xenopus laevis GN=cdk2 PE=1 SV=3 152 524 7.0E-17
sp|Q39024|MPK4_ARATH Mitogen-activated protein kinase 4 OS=Arabidopsis thaliana GN=MPK4 PE=1 SV=2 284 518 7.0E-17
sp|Q8SRU0|CSK2A_ENCCU Probable casein kinase II subunit alpha homolog OS=Encephalitozoon cuniculi (strain GB-M1) GN=CKA1 PE=3 SV=1 149 515 7.0E-17
sp|P18334|CSK2A_CAEEL Casein kinase II subunit alpha OS=Caenorhabditis elegans GN=kin-3 PE=1 SV=1 261 519 7.0E-17
sp|Q10452|GSK3_SCHPO Protein kinase gsk3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gsk3 PE=1 SV=3 232 518 8.0E-17
sp|Q5AAG6|MKC1_CANAL Mitogen-activated protein kinase MKC1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MKC1 PE=1 SV=1 153 528 1.0E-16
sp|Q13164|MK07_HUMAN Mitogen-activated protein kinase 7 OS=Homo sapiens GN=MAPK7 PE=1 SV=2 215 518 1.0E-16
sp|P43068|MKC1_CANAX Mitogen-activated protein kinase MKC1 OS=Candida albicans GN=MKC1 PE=3 SV=1 153 528 1.0E-16
sp|Q8GYQ5|MPK12_ARATH Mitogen-activated protein kinase 12 OS=Arabidopsis thaliana GN=MPK12 PE=1 SV=1 289 518 1.0E-16
sp|A5PKJ4|MK07_BOVIN Mitogen-activated protein kinase 7 OS=Bos taurus GN=MAPK7 PE=2 SV=1 215 518 2.0E-16
sp|O64817|CSK23_ARATH Probable casein kinase II subunit alpha OS=Arabidopsis thaliana GN=At2g23080 PE=1 SV=1 236 518 2.0E-16
sp|Q5R7I7|CDK20_PONAB Cyclin-dependent kinase 20 OS=Pongo abelii GN=CDK20 PE=2 SV=1 152 525 2.0E-16
sp|Q4Z6R1|CDC2H_PLABA Cell division control protein 2 homolog OS=Plasmodium berghei (strain Anka) GN=CRK2 PE=2 SV=1 152 522 3.0E-16
sp|P08181|CSK2A_DROME Casein kinase II subunit alpha OS=Drosophila melanogaster GN=CkIIalpha PE=1 SV=2 261 518 3.0E-16
sp|Q4Y4B1|CDC2H_PLACH Cell division control protein 2 homolog OS=Plasmodium chabaudi GN=CRK2 PE=3 SV=1 152 519 3.0E-16
sp|P29619|CDKA2_ORYSJ Cyclin-dependent kinase A-2 OS=Oryza sativa subsp. japonica GN=CDKA-2 PE=2 SV=1 152 519 4.0E-16
sp|P24788|CD11B_MOUSE Cyclin-dependent kinase 11B OS=Mus musculus GN=Cdk11b PE=1 SV=2 152 524 5.0E-16
sp|Q9C9M7|CDKD2_ARATH Cyclin-dependent kinase D-2 OS=Arabidopsis thaliana GN=CDKD-2 PE=1 SV=1 152 524 5.0E-16
sp|Q39023|MPK3_ARATH Mitogen-activated protein kinase 3 OS=Arabidopsis thaliana GN=MPK3 PE=1 SV=2 285 518 6.0E-16
sp|Q9JKV2|ICK_MOUSE Serine/threonine-protein kinase ICK OS=Mus musculus GN=Ick PE=1 SV=2 152 529 7.0E-16
sp|Q8IZL9|CDK20_HUMAN Cyclin-dependent kinase 20 OS=Homo sapiens GN=CDK20 PE=1 SV=1 152 525 8.0E-16
sp|P33674|CSK21_RABIT Casein kinase II subunit alpha OS=Oryctolagus cuniculus GN=CSNK2A1 PE=2 SV=1 149 518 8.0E-16
sp|Q9UPZ9|ICK_HUMAN Serine/threonine-protein kinase ICK OS=Homo sapiens GN=ICK PE=1 SV=1 215 533 8.0E-16
sp|Q9JHU3|CDK20_MOUSE Cyclin-dependent kinase 20 OS=Mus musculus GN=Cdk20 PE=1 SV=1 152 525 8.0E-16
sp|Q8TG13|CSK2A_NEUCR Casein kinase II subunit alpha OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=cka PE=2 SV=1 236 518 1.0E-15
sp|Q5J4W4|MPK2_ORYSJ Mitogen-activated protein kinase 2 OS=Oryza sativa subsp. japonica GN=MPK2 PE=2 SV=1 285 518 1.0E-15
sp|Q62726|ICK_RAT Serine/threonine-protein kinase ICK OS=Rattus norvegicus GN=Ick PE=1 SV=1 152 529 1.0E-15
sp|P19139|CSK21_RAT Casein kinase II subunit alpha OS=Rattus norvegicus GN=Csnk2a1 PE=1 SV=2 149 518 2.0E-15
sp|Q60737|CSK21_MOUSE Casein kinase II subunit alpha OS=Mus musculus GN=Csnk2a1 PE=1 SV=2 149 518 2.0E-15
sp|Q9XZD6|CDC2H_PLAVI Cell division control protein 2 homolog OS=Plasmodium vivax GN=CRK2 PE=3 SV=1 152 522 2.0E-15
sp|P68400|CSK21_HUMAN Casein kinase II subunit alpha OS=Homo sapiens GN=CSNK2A1 PE=1 SV=1 149 518 2.0E-15
sp|P68399|CSK21_BOVIN Casein kinase II subunit alpha OS=Bos taurus GN=CSNK2A1 PE=1 SV=1 149 518 2.0E-15
sp|Q07785|CDC2H_PLAFK Cell division control protein 2 homolog OS=Plasmodium falciparum (isolate K1 / Thailand) GN=CRK2 PE=1 SV=1 152 519 2.0E-15
sp|P61075|CDC2H_PLAF7 Cell division control protein 2 homolog OS=Plasmodium falciparum (isolate 3D7) GN=CRK2 PE=3 SV=1 152 519 2.0E-15
sp|P23111|CDC2_MAIZE Cell division control protein 2 homolog OS=Zea mays GN=CDC2 PE=2 SV=1 152 519 2.0E-15
sp|P21868|CSK21_CHICK Casein kinase II subunit alpha OS=Gallus gallus GN=CSNK2A1 PE=2 SV=1 149 518 2.0E-15
sp|Q8NEV1|CSK23_HUMAN Casein kinase II subunit alpha 3 OS=Homo sapiens GN=CSNK2A3 PE=1 SV=2 149 518 2.0E-15
sp|Q9URT9|GSK31_SCHPO Protein kinase gsk31 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gsk31 PE=1 SV=1 212 518 3.0E-15
sp|Q7RM49|CDC2H_PLAYO Cell division control protein 2 homolog OS=Plasmodium yoelii yoelii GN=CRK2 PE=3 SV=1 152 522 3.0E-15
sp|P54119|CDK1_AJECA Cyclin-dependent kinase 1 OS=Ajellomyces capsulatus GN=CDC2 PE=3 SV=1 152 527 4.0E-15
sp|Q11179|YPC2_CAEEL Putative serine/threonine-protein kinase C05D10.2 OS=Caenorhabditis elegans GN=C05D10.2 PE=3 SV=2 152 527 4.0E-15
sp|P15790|CSK21_YEAST Casein kinase II subunit alpha OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CKA1 PE=1 SV=1 261 518 4.0E-15
sp|Q9UQ88|CD11A_HUMAN Cyclin-dependent kinase 11A OS=Homo sapiens GN=CDK11A PE=1 SV=4 152 524 4.0E-15
sp|P28020|CSK21_XENLA Casein kinase II subunit alpha OS=Xenopus laevis GN=csnk2a1 PE=2 SV=2 149 518 5.0E-15
sp|Q40353|MMK2_MEDSA Mitogen-activated protein kinase homolog MMK2 OS=Medicago sativa GN=MMK2 PE=2 SV=1 285 518 5.0E-15
sp|O96821|CDC2H_PLAKH Cell division control protein 2 homolog OS=Plasmodium knowlesi (strain H) GN=CRK2 PE=3 SV=1 152 519 7.0E-15
sp|Q55C57|GLKA_DICDI Probable serine/threonine-protein kinase glkA OS=Dictyostelium discoideum GN=glkA PE=3 SV=1 154 531 8.0E-15
sp|Q39021|MPK1_ARATH Mitogen-activated protein kinase 1 OS=Arabidopsis thaliana GN=MPK1 PE=1 SV=2 285 518 8.0E-15
sp|O64816|CSK2P_ARATH Casein kinase II subunit alpha, chloroplastic OS=Arabidopsis thaliana GN=At2g23070 PE=2 SV=1 236 518 8.0E-15
sp|Q6C842|BUR1_YARLI Serine/threonine-protein kinase BUR1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=BUR1 PE=3 SV=1 152 524 9.0E-15
sp|P51952|CDK7_RAT Cyclin-dependent kinase 7 (Fragment) OS=Rattus norvegicus GN=Cdk7 PE=1 SV=2 160 528 1.0E-14
sp|Q9WV60|GSK3B_MOUSE Glycogen synthase kinase-3 beta OS=Mus musculus GN=Gsk3b PE=1 SV=2 278 518 2.0E-14
sp|P06242|KIN28_YEAST Serine/threonine-protein kinase KIN28 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KIN28 PE=1 SV=1 230 519 2.0E-14
sp|P49841|GSK3B_HUMAN Glycogen synthase kinase-3 beta OS=Homo sapiens GN=GSK3B PE=1 SV=2 278 518 2.0E-14
sp|Q5YJC2|GSK3B_SPECI Glycogen synthase kinase-3 beta OS=Spermophilus citellus GN=GSK3B PE=2 SV=1 278 518 2.0E-14
sp|P18266|GSK3B_RAT Glycogen synthase kinase-3 beta OS=Rattus norvegicus GN=Gsk3b PE=1 SV=1 278 518 2.0E-14
sp|Q0J4I1|CKB21_ORYSJ Cyclin-dependent kinase B2-1 OS=Oryza sativa subsp. japonica GN=CDKB2-1 PE=1 SV=1 152 518 3.0E-14
sp|O76484|CSK2A_SPOFR Casein kinase II subunit alpha OS=Spodoptera frugiperda PE=2 SV=1 261 518 3.0E-14
sp|Q39025|MPK5_ARATH Mitogen-activated protein kinase 5 OS=Arabidopsis thaliana GN=MPK5 PE=2 SV=2 285 520 3.0E-14
sp|Q55FJ6|Y8078_DICDI Probable serine/threonine-protein kinase DDB_G0268078 OS=Dictyostelium discoideum GN=DDB_G0268078 PE=3 SV=1 152 521 3.0E-14
sp|Q00772|SLT2_YEAST Mitogen-activated protein kinase SLT2/MPK1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SLT2 PE=1 SV=2 153 518 3.0E-14
sp|Q39022|MPK2_ARATH Mitogen-activated protein kinase 2 OS=Arabidopsis thaliana GN=MPK2 PE=1 SV=2 285 518 4.0E-14
sp|Q00537|CDK17_HUMAN Cyclin-dependent kinase 17 OS=Homo sapiens GN=CDK17 PE=1 SV=2 149 520 4.0E-14
sp|Q9M1Z5|MPK10_ARATH Mitogen-activated protein kinase 10 OS=Arabidopsis thaliana GN=MPK10 PE=1 SV=1 285 520 4.0E-14
sp|P14681|KSS1_YEAST Mitogen-activated protein kinase KSS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KSS1 PE=1 SV=1 153 533 4.0E-14
sp|Q2NL51|GSK3A_MOUSE Glycogen synthase kinase-3 alpha OS=Mus musculus GN=Gsk3a PE=1 SV=2 282 537 5.0E-14
sp|P50613|CDK7_HUMAN Cyclin-dependent kinase 7 OS=Homo sapiens GN=CDK7 PE=1 SV=1 153 528 5.0E-14
sp|Q03147|CDK7_MOUSE Cyclin-dependent kinase 7 OS=Mus musculus GN=Cdk7 PE=1 SV=2 153 440 7.0E-14
sp|Q54QB1|ERK2_DICDI Extracellular signal-regulated kinase 2 OS=Dictyostelium discoideum GN=erkB PE=1 SV=1 153 527 7.0E-14
sp|Q63844|MK03_MOUSE Mitogen-activated protein kinase 3 OS=Mus musculus GN=Mapk3 PE=1 SV=5 282 518 8.0E-14
sp|P21708|MK03_RAT Mitogen-activated protein kinase 3 OS=Rattus norvegicus GN=Mapk3 PE=1 SV=5 282 518 8.0E-14
sp|Q91757|GSK3B_XENLA Glycogen synthase kinase-3 beta OS=Xenopus laevis GN=gsk3b PE=1 SV=1 277 537 9.0E-14
sp|Q40518|MSK1_TOBAC Shaggy-related protein kinase NtK-1 OS=Nicotiana tabacum GN=NTK-1 PE=2 SV=1 277 518 9.0E-14
sp|P27361|MK03_HUMAN Mitogen-activated protein kinase 3 OS=Homo sapiens GN=MAPK3 PE=1 SV=4 282 518 9.0E-14
sp|P40417|ERKA_DROME Mitogen-activated protein kinase ERK-A OS=Drosophila melanogaster GN=rl PE=1 SV=3 282 527 1.0E-13
sp|P20911|CDK7_XENLA Cyclin-dependent kinase 7 OS=Xenopus laevis GN=cdk7 PE=1 SV=1 153 528 1.0E-13
sp|P36005|KDX1_YEAST Serine/threonine-protein kinase KDX1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KDX1 PE=1 SV=1 214 518 2.0E-13
sp|Q8K0D0|CDK17_MOUSE Cyclin-dependent kinase 17 OS=Mus musculus GN=Cdk17 PE=1 SV=2 149 520 2.0E-13
sp|O08911|MK12_MOUSE Mitogen-activated protein kinase 12 OS=Mus musculus GN=Mapk12 PE=1 SV=1 215 520 2.0E-13
sp|Q17446|PMK1_CAEEL Mitogen-activated protein kinase pmk-1 OS=Caenorhabditis elegans GN=pmk-1 PE=1 SV=1 282 520 2.0E-13
sp|P46892|CD11B_RAT Cyclin-dependent kinase 11B OS=Rattus norvegicus GN=Cdk11b PE=1 SV=1 249 524 3.0E-13
sp|Q9LQQ9|MPK13_ARATH Mitogen-activated protein kinase 13 OS=Arabidopsis thaliana GN=MPK13 PE=1 SV=1 285 518 3.0E-13
sp|Q39010|KSG6_ARATH Shaggy-related protein kinase zeta OS=Arabidopsis thaliana GN=ASK6 PE=2 SV=2 277 537 3.0E-13
sp|A8XSC1|NLK_CAEBR Serine/threonine kinase NLK OS=Caenorhabditis briggsae GN=lit-1 PE=3 SV=2 275 523 4.0E-13
sp|P51953|CDK7_CARAU Cyclin-dependent kinase 7 OS=Carassius auratus GN=cdk7 PE=2 SV=1 154 440 4.0E-13
sp|Q66HE7|CDKL1_RAT Cyclin-dependent kinase-like 1 OS=Rattus norvegicus GN=Cdkl1 PE=2 SV=1 152 518 4.0E-13
sp|P97377|CDK2_MOUSE Cyclin-dependent kinase 2 OS=Mus musculus GN=Cdk2 PE=1 SV=2 152 411 4.0E-13
sp|Q39011|KSG7_ARATH Shaggy-related protein kinase eta OS=Arabidopsis thaliana GN=ASK7 PE=1 SV=2 277 518 4.0E-13
sp|P15735|PHKG2_HUMAN Phosphorylase b kinase gamma catalytic chain, liver/testis isoform OS=Homo sapiens GN=PHKG2 PE=1 SV=1 237 518 5.0E-13
sp|P20793|MAK_RAT Serine/threonine-protein kinase MAK OS=Rattus norvegicus GN=Mak PE=1 SV=2 230 525 5.0E-13
sp|Q9U9Y8|NLK_CAEEL Serine/threonine kinase NLK OS=Caenorhabditis elegans GN=lit-1 PE=1 SV=1 248 523 5.0E-13
sp|P51137|MSK1_MEDSA Glycogen synthase kinase-3 homolog MsK-1 OS=Medicago sativa GN=MSK-1 PE=2 SV=1 277 518 5.0E-13
sp|O94737|MAPK1_PNECA Mitogen-activated protein kinase 1 OS=Pneumocystis carinii GN=MKP1 PE=1 SV=1 154 527 6.0E-13
sp|P53778|MK12_HUMAN Mitogen-activated protein kinase 12 OS=Homo sapiens GN=MAPK12 PE=1 SV=3 215 520 6.0E-13
sp|P20794|MAK_HUMAN Serine/threonine-protein kinase MAK OS=Homo sapiens GN=MAK PE=1 SV=2 230 525 7.0E-13
sp|Q04859|MAK_MOUSE Serine/threonine-protein kinase MAK OS=Mus musculus GN=Mak PE=1 SV=2 215 525 7.0E-13
sp|O35832|CKD18_RAT Cyclin-dependent kinase 18 OS=Rattus norvegicus GN=Cdk18 PE=1 SV=1 149 440 8.0E-13
sp|P0CP66|CPK1_CRYNJ Mitogen-activated protein kinase CPK1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=CPK1 PE=3 SV=1 285 527 8.0E-13
sp|P0CP67|CPK1_CRYNB Mitogen-activated protein kinase CPK1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=CPK1 PE=3 SV=1 285 527 8.0E-13
sp|Q63538|MK12_RAT Mitogen-activated protein kinase 12 OS=Rattus norvegicus GN=Mapk12 PE=1 SV=1 215 520 1.0E-12
sp|Q1DUU8|HOG1_COCIM Mitogen-activated protein kinase HOG1 OS=Coccidioides immitis (strain RS) GN=HOG1 PE=3 SV=1 215 518 1.0E-12
sp|Q40884|MPK_PETHY Mitogen-activated protein kinase homolog 1 OS=Petunia hybrida GN=MPK1 PE=2 SV=1 285 518 1.0E-12
sp|O35831|CDK17_RAT Cyclin-dependent kinase 17 OS=Rattus norvegicus GN=Cdk17 PE=1 SV=1 149 520 1.0E-12
sp|P46196|MK01_BOVIN Mitogen-activated protein kinase 1 OS=Bos taurus GN=MAPK1 PE=2 SV=3 282 518 1.0E-12
sp|P28482|MK01_HUMAN Mitogen-activated protein kinase 1 OS=Homo sapiens GN=MAPK1 PE=1 SV=3 282 518 2.0E-12
sp|Q5Z859|MPK4_ORYSJ Mitogen-activated protein kinase 4 OS=Oryza sativa subsp. japonica GN=MPK4 PE=2 SV=1 285 518 2.0E-12
sp|P63086|MK01_RAT Mitogen-activated protein kinase 1 OS=Rattus norvegicus GN=Mapk1 PE=1 SV=3 282 518 2.0E-12
sp|P63085|MK01_MOUSE Mitogen-activated protein kinase 1 OS=Mus musculus GN=Mapk1 PE=1 SV=3 282 518 2.0E-12
sp|P31325|PHKG2_RAT Phosphorylase b kinase gamma catalytic chain, liver/testis isoform OS=Rattus norvegicus GN=Phkg2 PE=1 SV=1 236 518 2.0E-12
sp|Q2KJ16|PHKG2_BOVIN Phosphorylase b kinase gamma catalytic chain, liver/testis isoform OS=Bos taurus GN=PHKG2 PE=2 SV=1 237 518 2.0E-12
sp|Q06060|MPK_PEA Mitogen-activated protein kinase homolog D5 OS=Pisum sativum PE=2 SV=1 285 518 3.0E-12
sp|Q27032|CDC2H_THEPA Cell division control protein 2 homolog OS=Theileria parva GN=CRK2 PE=3 SV=1 153 519 3.0E-12
sp|P41808|SMK1_YEAST Sporulation-specific mitogen-activated protein kinase SMK1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SMK1 PE=1 SV=1 282 524 3.0E-12
sp|Q07176|MMK1_MEDSA Mitogen-activated protein kinase homolog MMK1 OS=Medicago sativa GN=MMK1 PE=1 SV=1 285 518 3.0E-12
sp|P54664|CC2H1_TRYCO Cell division control protein 2 homolog 1 OS=Trypanosoma congolense GN=CRK1 PE=3 SV=1 152 518 4.0E-12
sp|Q26671|CDC2H_THEAN Cell division control protein 2 homolog OS=Theileria annulata GN=CRK2 PE=2 SV=1 153 528 4.0E-12
sp|Q39026|MPK6_ARATH Mitogen-activated protein kinase 6 OS=Arabidopsis thaliana GN=MPK6 PE=1 SV=1 285 520 4.0E-12
sp|Q9LE81|IRE_ARATH Probable serine/threonine protein kinase IRE OS=Arabidopsis thaliana GN=IRE PE=2 SV=1 122 421 4.0E-12
sp|Q8CEQ0|CDKL1_MOUSE Cyclin-dependent kinase-like 1 OS=Mus musculus GN=Cdkl1 PE=2 SV=1 152 530 4.0E-12
sp|P43289|KSG3_ARATH Shaggy-related protein kinase gamma OS=Arabidopsis thaliana GN=ASK3 PE=2 SV=1 277 518 5.0E-12
sp|Q10N20|MPK5_ORYSJ Mitogen-activated protein kinase 5 OS=Oryza sativa subsp. japonica GN=MPK5 PE=1 SV=1 285 518 5.0E-12
sp|A2XFC8|MPK5_ORYSI Mitogen-activated protein kinase 5 OS=Oryza sativa subsp. indica GN=MPK5 PE=1 SV=2 285 518 5.0E-12
sp|P43288|KSG1_ARATH Shaggy-related protein kinase alpha OS=Arabidopsis thaliana GN=ASK1 PE=1 SV=3 277 518 6.0E-12
sp|O42781|MAPK2_PNECA Mitogen-activated protein kinase 2 OS=Pneumocystis carinii GN=MKP2 PE=1 SV=1 285 518 6.0E-12
sp|Q84UI5|MPK1_ORYSJ Mitogen-activated protein kinase 1 OS=Oryza sativa subsp. japonica GN=MPK1 PE=1 SV=1 285 518 7.0E-12
sp|Q6CRA9|BUR1_KLULA Serine/threonine-protein kinase BUR1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=BUR1 PE=3 SV=1 150 533 8.0E-12
sp|Q8VZD5|KSG5_ARATH Shaggy-related protein kinase epsilon OS=Arabidopsis thaliana GN=ASK5 PE=2 SV=1 277 518 8.0E-12
sp|Q39012|KSG9_ARATH Shaggy-related protein kinase iota OS=Arabidopsis thaliana GN=ASK9 PE=2 SV=1 277 537 9.0E-12
sp|P51138|MSK2_MEDSA Glycogen synthase kinase-3 homolog MsK-2 OS=Medicago sativa GN=MSK-2 PE=2 SV=1 254 518 9.0E-12
sp|P51139|MSK3_MEDSA Glycogen synthase kinase-3 homolog MsK-3 OS=Medicago sativa GN=MSK-3 PE=2 SV=2 277 517 1.0E-11
sp|O62618|MK14A_DROME Mitogen-activated protein kinase 14A OS=Drosophila melanogaster GN=Mpk2 PE=1 SV=1 257 527 1.0E-11
sp|Q40532|NTF4_TOBAC Mitogen-activated protein kinase homolog NTF4 OS=Nicotiana tabacum GN=NTF4 PE=2 SV=1 285 518 1.0E-11
sp|Q5A1D3|ERK1_CANAL Extracellular signal-regulated kinase 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CEK1 PE=1 SV=2 282 527 1.0E-11
sp|Q922Y0|DYRK3_MOUSE Dual specificity tyrosine-phosphorylation-regulated kinase 3 OS=Mus musculus GN=Dyrk3 PE=1 SV=1 274 518 2.0E-11
sp|C4YGK0|ERK1_CANAW Extracellular signal-regulated kinase 1 OS=Candida albicans (strain WO-1) GN=CEK1 PE=3 SV=1 282 527 2.0E-11
sp|P83100|MK14C_DROME Putative mitogen-activated protein kinase 14C OS=Drosophila melanogaster GN=p38c PE=2 SV=1 257 519 2.0E-11
sp|Q6Z437|MPK3_ORYSJ Mitogen-activated protein kinase 3 OS=Oryza sativa subsp. japonica GN=MPK3 PE=2 SV=1 285 518 2.0E-11
sp|Q4P9T2|SSN3_USTMA Serine/threonine-protein kinase SSN3 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SSN3 PE=3 SV=2 286 522 3.0E-11
sp|Q6C4M9|HOG1_YARLI Mitogen-activated protein kinase HOG1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=HOG1 PE=3 SV=1 215 518 3.0E-11
sp|P47811|MK14_MOUSE Mitogen-activated protein kinase 14 OS=Mus musculus GN=Mapk14 PE=1 SV=3 215 518 5.0E-11
sp|Q9FVS6|KSG4_ARATH Shaggy-related protein kinase delta OS=Arabidopsis thaliana GN=ASK4 PE=2 SV=1 215 518 5.0E-11
sp|P70618|MK14_RAT Mitogen-activated protein kinase 14 OS=Rattus norvegicus GN=Mapk14 PE=1 SV=3 215 518 5.0E-11
sp|Q9Z2A6|MK15_RAT Mitogen-activated protein kinase 15 OS=Rattus norvegicus GN=Mapk15 PE=1 SV=2 152 527 6.0E-11
sp|Q16539|MK14_HUMAN Mitogen-activated protein kinase 14 OS=Homo sapiens GN=MAPK14 PE=1 SV=3 215 518 6.0E-11
sp|O61443|MK14B_DROME Mitogen-activated protein kinase 14B OS=Drosophila melanogaster GN=p38b PE=1 SV=1 257 518 6.0E-11
sp|P43294|MHK_ARATH Serine/threonine-protein kinase MHK OS=Arabidopsis thaliana GN=MHK PE=2 SV=2 281 521 7.0E-11
sp|Q12706|PSK1_SCHPO Serine/threonine-protein kinase psk1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=psk1 PE=3 SV=1 231 436 1.0E-10
sp|P48562|CLA4_YEAST Serine/threonine-protein kinase CLA4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CLA4 PE=1 SV=1 154 521 1.0E-10
sp|O02812|MK14_CANLF Mitogen-activated protein kinase 14 OS=Canis lupus familiaris GN=MAPK14 PE=2 SV=3 215 518 1.0E-10
sp|Q6BM25|SSN3_DEBHA Serine/threonine-protein kinase SSN3 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=SSN3 PE=3 SV=2 258 518 2.0E-10
sp|Q80Y86|MK15_MOUSE Mitogen-activated protein kinase 15 OS=Mus musculus GN=Mapk15 PE=1 SV=1 289 536 2.0E-10
sp|F4HYG2|IRE3_ARATH Probable serine/threonine protein kinase IRE3 OS=Arabidopsis thaliana GN=IRE3 PE=2 SV=1 229 421 3.0E-10
sp|Q00859|MAPK_FUSSO Mitogen-activated protein kinase OS=Fusarium solani subsp. pisi GN=MAPK PE=2 SV=1 285 443 4.0E-10
sp|O15264|MK13_HUMAN Mitogen-activated protein kinase 13 OS=Homo sapiens GN=MAPK13 PE=1 SV=1 209 518 5.0E-10
sp|Q9W0V1|PDPK1_DROME 3-phosphoinositide-dependent protein kinase 1 OS=Drosophila melanogaster GN=Pdk1 PE=1 SV=4 158 428 6.0E-10
sp|Q3T0N5|MK13_BOVIN Mitogen-activated protein kinase 13 OS=Bos taurus GN=MAPK13 PE=2 SV=1 209 518 1.0E-09
sp|Q9N272|MK13_PANTR Mitogen-activated protein kinase 13 OS=Pan troglodytes GN=MAPK13 PE=2 SV=1 282 518 2.0E-09
sp|O94324|PPK31_SCHPO Serine/threonine-protein kinase ppk31 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppk31 PE=1 SV=1 209 446 2.0E-09
sp|O95835|LATS1_HUMAN Serine/threonine-protein kinase LATS1 OS=Homo sapiens GN=LATS1 PE=1 SV=1 245 422 2.0E-09
sp|O94487|PPK35_SCHPO Serine/threonine-protein kinase ppk35 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppk35 PE=1 SV=1 229 425 2.0E-09
sp|Q09898|SID2_SCHPO Serine/threonine-protein kinase sid2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sid2 PE=1 SV=1 248 426 2.0E-09
sp|Q92398|SPM1_SCHPO Mitogen-activated protein kinase spm1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=spm1 PE=1 SV=1 215 536 2.0E-09
sp|Q8BYR2|LATS1_MOUSE Serine/threonine-protein kinase LATS1 OS=Mus musculus GN=Lats1 PE=1 SV=3 245 422 3.0E-09
sp|Q9NGW9|MKCB_DICDI Probable serine/threonine-protein kinase mkcB OS=Dictyostelium discoideum GN=mkcB PE=2 SV=1 150 522 3.0E-09
sp|Q9QZS5|SGK2_MOUSE Serine/threonine-protein kinase Sgk2 OS=Mus musculus GN=Sgk2 PE=1 SV=1 235 453 6.0E-09
sp|B4MXR8|PLK4_DROWI Serine/threonine-protein kinase PLK4 OS=Drosophila willistoni GN=SAK PE=3 SV=1 209 518 6.0E-09
sp|Q12236|PKH2_YEAST Serine/threonine-protein kinase PKH2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PKH2 PE=1 SV=1 124 421 6.0E-09
sp|Q09831|PPK14_SCHPO Serine/threonine-protein kinase ppk14 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppk14 PE=1 SV=1 243 421 1.0E-08
sp|Q54IH8|NDRB_DICDI Probable serine/threonine-protein kinase ndrB OS=Dictyostelium discoideum GN=ndrB PE=3 SV=1 243 421 1.0E-08
sp|Q8R4U9|SGK2_RAT Serine/threonine-protein kinase Sgk2 OS=Rattus norvegicus GN=Sgk2 PE=1 SV=2 218 453 2.0E-08
sp|Q54BC9|DYRK2_DICDI Probable serine/threonine-protein kinase dyrk2 OS=Dictyostelium discoideum GN=dyrk2 PE=3 SV=1 289 524 3.0E-08
sp|Q59KM8|DBF2_CANAL Cell cycle protein kinase DBF2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=DBF2 PE=2 SV=1 218 427 3.0E-08
sp|Q54P47|NDRC_DICDI Probable serine/threonine-protein kinase ndrC OS=Dictyostelium discoideum GN=ndrC PE=3 SV=1 245 421 3.0E-08
sp|P53599|SSK2_YEAST MAP kinase kinase kinase SSK2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SSK2 PE=1 SV=1 215 513 5.0E-08
sp|Q8SRL5|IPL1_ENCCU Probable spindle assembly checkpoint kinase homolog OS=Encephalitozoon cuniculi (strain GB-M1) GN=IPL1 PE=3 SV=1 213 421 6.0E-08
sp|Q3U214|MAST3_MOUSE Microtubule-associated serine/threonine-protein kinase 3 OS=Mus musculus GN=Mast3 PE=1 SV=3 243 423 7.0E-08
sp|Q940A2|P2C31_ARATH Protein kinase and PP2C-like domain-containing protein OS=Arabidopsis thaliana GN=At2g40860/At2g40870 PE=2 SV=1 213 513 7.0E-08
sp|Q5Z754|CDKF1_ORYSJ Cyclin-dependent kinase F-1 OS=Oryza sativa subsp. japonica GN=CDKF-1 PE=2 SV=1 381 524 7.0E-08
sp|O42626|NRC2_NEUCR Serine/threonine-protein kinase nrc-2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=nrc-2 PE=3 SV=1 228 421 7.0E-08
sp|A2YCH5|CDKF1_ORYSI Cyclin-dependent kinase F-1 OS=Oryza sativa subsp. indica GN=CDKF-1 PE=3 SV=1 381 524 8.0E-08
sp|O60307|MAST3_HUMAN Microtubule-associated serine/threonine-protein kinase 3 OS=Homo sapiens GN=MAST3 PE=1 SV=2 243 423 9.0E-08
sp|O75582|KS6A5_HUMAN Ribosomal protein S6 kinase alpha-5 OS=Homo sapiens GN=RPS6KA5 PE=1 SV=1 232 421 1.0E-07
sp|P93025|PHOT2_ARATH Phototropin-2 OS=Arabidopsis thaliana GN=PHOT2 PE=1 SV=2 243 464 1.0E-07
sp|P32328|DBF20_YEAST Serine/threonine-protein kinase DBF20 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DBF20 PE=1 SV=2 218 427 2.0E-07
sp|Q8C050|KS6A5_MOUSE Ribosomal protein S6 kinase alpha-5 OS=Mus musculus GN=Rps6ka5 PE=1 SV=2 231 421 2.0E-07
sp|Q9NBK5|TRC_DROME Serine/threonine-protein kinase tricorner OS=Drosophila melanogaster GN=trc PE=1 SV=1 245 421 2.0E-07
sp|Q9Y2H1|ST38L_HUMAN Serine/threonine-protein kinase 38-like OS=Homo sapiens GN=STK38L PE=1 SV=3 245 421 2.0E-07
sp|P22204|DBF2_YEAST Cell cycle protein kinase DBF2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DBF2 PE=1 SV=3 218 427 3.0E-07
sp|Q2LZZ7|TRC_DROPS Serine/threonine-protein kinase tricorner OS=Drosophila pseudoobscura pseudoobscura GN=trc PE=3 SV=1 245 421 3.0E-07
sp|Q9ST27|PHOT2_ORYSJ Phototropin-2 OS=Oryza sativa subsp. japonica GN=PHOT2 PE=1 SV=1 233 421 3.0E-07
sp|Q54W86|MYLKF_DICDI Probable myosin light chain kinase DDB_G0279831 OS=Dictyostelium discoideum GN=DDB_G0279831 PE=3 SV=1 286 529 3.0E-07
sp|Q7TSE6|ST38L_MOUSE Serine/threonine-protein kinase 38-like OS=Mus musculus GN=Stk38l PE=1 SV=2 245 421 6.0E-07
sp|Q8MYF1|Y2070_DICDI Probable serine/threonine-protein kinase DDB_G0277449 OS=Dictyostelium discoideum GN=DDB_G0277449 PE=3 SV=1 216 421 6.0E-07
sp|P16912|KDC2_DROME Protein kinase DC2 OS=Drosophila melanogaster GN=Pka-C3 PE=2 SV=2 152 423 1.0E-06
sp|A2VDV2|STK38_BOVIN Serine/threonine-protein kinase 38 OS=Bos taurus GN=STK38 PE=2 SV=1 245 421 1.0E-06
sp|Q91VJ4|STK38_MOUSE Serine/threonine-protein kinase 38 OS=Mus musculus GN=Stk38 PE=1 SV=1 245 421 2.0E-06
sp|Q5R8M1|STK38_PONAB Serine/threonine-protein kinase 38 OS=Pongo abelii GN=STK38 PE=2 SV=1 245 421 2.0E-06
sp|Q15208|STK38_HUMAN Serine/threonine-protein kinase 38 OS=Homo sapiens GN=STK38 PE=1 SV=1 245 421 2.0E-06
sp|Q8IU85|KCC1D_HUMAN Calcium/calmodulin-dependent protein kinase type 1D OS=Homo sapiens GN=CAMK1D PE=1 SV=1 281 426 3.0E-06
sp|Q8BW96|KCC1D_MOUSE Calcium/calmodulin-dependent protein kinase type 1D OS=Mus musculus GN=Camk1d PE=1 SV=2 281 427 4.0E-06
sp|O74304|WIN1_SCHPO MAP kinase kinase kinase win1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=win1 PE=1 SV=1 160 435 5.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005524 ATP binding Yes
GO:0004672 protein kinase activity Yes
GO:0006468 protein phosphorylation Yes
GO:0044238 primary metabolic process No
GO:0016773 phosphotransferase activity, alcohol group as acceptor No
GO:0032559 adenyl ribonucleotide binding No
GO:0097159 organic cyclic compound binding No
GO:0006793 phosphorus metabolic process No
GO:0071704 organic substance metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0005488 binding No
GO:1901265 nucleoside phosphate binding No
GO:0044267 cellular protein metabolic process No
GO:0044237 cellular metabolic process No
GO:0008152 metabolic process No
GO:0008150 biological_process No
GO:0036094 small molecule binding No
GO:0016301 kinase activity No
GO:0044260 cellular macromolecule metabolic process No
GO:0008144 drug binding No
GO:0036211 protein modification process No
GO:0016740 transferase activity No
GO:0003674 molecular_function No
GO:0016772 transferase activity, transferring phosphorus-containing groups No
GO:0003824 catalytic activity No
GO:0016310 phosphorylation No
GO:0009987 cellular process No
GO:1901564 organonitrogen compound metabolic process No
GO:0006464 cellular protein modification process No
GO:1901363 heterocyclic compound binding No
GO:0000166 nucleotide binding No
GO:0043167 ion binding No
GO:0043168 anion binding No
GO:0097367 carbohydrate derivative binding No
GO:0043170 macromolecule metabolic process No
GO:0032555 purine ribonucleotide binding No
GO:0019538 protein metabolic process No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0032553 ribonucleotide binding No
GO:0030554 adenyl nucleotide binding No
GO:0140096 catalytic activity, acting on a protein No
GO:0006796 phosphate-containing compound metabolic process No
GO:0043412 macromolecule modification No
GO:0017076 purine nucleotide binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 39 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|7159
MTANDHRHAPEPFEIHEDARTEETVVMAEDETGADNLTSAVDAGAAEHDVLANEDGEEATVDMQGTEELDGTIGD
AEEVREEIDFDQEEEHEEEGGHGKDNDEDEDEDADADNDDDDDDDDDDDESSDDDQVESSVQADMDKLQGDFPGF
RDKYRLIKRIGEGTFSTVFKAEDIHYNRYDNSWDLQDGPSKWTPPPLRKRPHAASQPLRRRPRYVAIKKIYVTSS
PARILNELELLHDLRQCPSVCPLITAFRHTDQVVAILPYFRHGDFRTYFRDMTIPDIAIYLRSLFTALSSVHASK
ILHRDIKPTNFLYDPASQHGVLVDFGLAEREGSDCRPCLCHEPREVRKLRQANSVWAQSTAASQPGYPKSDTRPS
RRANRAGTRGFRAPEVLFKCTEQTTAIDIWSVGVILLTILSKRFPFFNSADDVEAMIEIATIFGSKRMKAAGLLH
GCVFETNIPTVGQQGFSMEKIILWSTCRTDDKPLTADEKLAVRFLERCMELDPSRRITADQALEHDFLRAADLPG
RELGDDDEMDMLET*
Coding >Hirsu2|7159
ATGACGGCCAACGACCACCGTCACGCCCCAGAGCCCTTCGAGATCCACGAGGATGCTCGGACCGAGGAGACGGTC
GTCATGGCCGAGGACGAGACCGGGGCTGACAACTTGACCTCCGCCGTCGACGCGGGAGCTGCAGAGCACGACGTT
CTGGCCAATGAAGACGGAGAGGAGGCCACGGTCGATATGCAAGGGACGGAGGAGCTGGACGGGACCATAGGGGAC
GCGGAAGAGGTGCGCGAGGAGATCGATTTCGACCAAGAGGAAGAGCACGAGGAGGAAGGCGGGCACGGCAAGGAT
AATGATGAAGACGAGGACGAAGACGCCGACGCCGACAACGACGACGACGACGACGACGATGACGACGACGACGAG
AGTTCCGACGACGATCAGGTCGAGAGCAGCGTCCAAGCCGACATGGACAAGTTACAGGGAGACTTTCCAGGCTTC
CGCGACAAGTATCGCTTGATCAAACGCATCGGCGAAGGTACTTTCTCGACCGTCTTCAAGGCCGAAGACATACAC
TACAACCGCTACGACAACAGCTGGGACTTGCAGGACGGTCCGTCCAAGTGGACGCCTCCGCCGCTCAGGAAACGC
CCGCACGCGGCGAGCCAGCCGCTGCGGCGGCGCCCGCGATACGTTGCCATCAAGAAGATCTACGTCACGTCGAGT
CCGGCCCGGATCCTCAACGAGCTCGAGCTTCTCCACGACCTCCGTCAGTGCCCGTCCGTCTGCCCGCTCATCACG
GCCTTCCGCCACACTGACCAGGTGGTGGCCATACTGCCCTACTTCCGCCACGGCGACTTCCGTACCTACTTCCGC
GACATGACCATCCCGGACATCGCCATCTACCTGCGCTCCCTCTTCACCGCCCTCAGCAGCGTCCACGCCAGCAAG
ATCCTGCACCGCGACATCAAGCCCACAAACTTCCTCTACGACCCGGCCTCGCAGCACGGCGTCCTCGTCGACTTC
GGCCTGGCCGAGCGCGAGGGCTCCGACTGCCGGCCCTGCCTCTGTCACGAGCCGCGCGAGGTCCGCAAGCTGCGC
CAGGCCAACTCGGTCTGGGCCCAGTCCACTGCCGCGTCGCAGCCTGGCTACCCCAAGTCCGACACGCGGCCCTCG
CGTCGCGCCAACCGTGCCGGCACCAGGGGCTTCCGCGCCCCCGAGGTGCTCTTCAAGTGCACCGAGCAGACGACG
GCCATCGACATCTGGTCCGTCGGCGTCATCCTCCTCACCATCCTGTCCAAGCGCTTCCCCTTCTTCAACTCGGCC
GACGACGTCGAGGCCATGATTGAGATAGCCACCATCTTCGGCTCCAAGCGGATGAAGGCCGCCGGCCTCCTGCAC
GGCTGCGTCTTCGAGACCAACATCCCCACCGTCGGCCAGCAGGGCTTCAGCATGGAGAAGATCATCCTCTGGAGC
ACCTGCCGCACCGACGACAAGCCACTGACGGCCGACGAGAAGCTGGCCGTCCGCTTCCTCGAGCGCTGCATGGAG
CTCGACCCCTCGAGGAGGATCACGGCCGACCAGGCCCTGGAGCACGACTTCCTGCGCGCCGCCGACTTGCCCGGC
CGGGAGCTGGGCGACGACGACGAGATGGACATGCTCGAGACGTAA
Transcript >Hirsu2|7159
ATGACGGCCAACGACCACCGTCACGCCCCAGAGCCCTTCGAGATCCACGAGGATGCTCGGACCGAGGAGACGGTC
GTCATGGCCGAGGACGAGACCGGGGCTGACAACTTGACCTCCGCCGTCGACGCGGGAGCTGCAGAGCACGACGTT
CTGGCCAATGAAGACGGAGAGGAGGCCACGGTCGATATGCAAGGGACGGAGGAGCTGGACGGGACCATAGGGGAC
GCGGAAGAGGTGCGCGAGGAGATCGATTTCGACCAAGAGGAAGAGCACGAGGAGGAAGGCGGGCACGGCAAGGAT
AATGATGAAGACGAGGACGAAGACGCCGACGCCGACAACGACGACGACGACGACGACGATGACGACGACGACGAG
AGTTCCGACGACGATCAGGTCGAGAGCAGCGTCCAAGCCGACATGGACAAGTTACAGGGAGACTTTCCAGGCTTC
CGCGACAAGTATCGCTTGATCAAACGCATCGGCGAAGGTACTTTCTCGACCGTCTTCAAGGCCGAAGACATACAC
TACAACCGCTACGACAACAGCTGGGACTTGCAGGACGGTCCGTCCAAGTGGACGCCTCCGCCGCTCAGGAAACGC
CCGCACGCGGCGAGCCAGCCGCTGCGGCGGCGCCCGCGATACGTTGCCATCAAGAAGATCTACGTCACGTCGAGT
CCGGCCCGGATCCTCAACGAGCTCGAGCTTCTCCACGACCTCCGTCAGTGCCCGTCCGTCTGCCCGCTCATCACG
GCCTTCCGCCACACTGACCAGGTGGTGGCCATACTGCCCTACTTCCGCCACGGCGACTTCCGTACCTACTTCCGC
GACATGACCATCCCGGACATCGCCATCTACCTGCGCTCCCTCTTCACCGCCCTCAGCAGCGTCCACGCCAGCAAG
ATCCTGCACCGCGACATCAAGCCCACAAACTTCCTCTACGACCCGGCCTCGCAGCACGGCGTCCTCGTCGACTTC
GGCCTGGCCGAGCGCGAGGGCTCCGACTGCCGGCCCTGCCTCTGTCACGAGCCGCGCGAGGTCCGCAAGCTGCGC
CAGGCCAACTCGGTCTGGGCCCAGTCCACTGCCGCGTCGCAGCCTGGCTACCCCAAGTCCGACACGCGGCCCTCG
CGTCGCGCCAACCGTGCCGGCACCAGGGGCTTCCGCGCCCCCGAGGTGCTCTTCAAGTGCACCGAGCAGACGACG
GCCATCGACATCTGGTCCGTCGGCGTCATCCTCCTCACCATCCTGTCCAAGCGCTTCCCCTTCTTCAACTCGGCC
GACGACGTCGAGGCCATGATTGAGATAGCCACCATCTTCGGCTCCAAGCGGATGAAGGCCGCCGGCCTCCTGCAC
GGCTGCGTCTTCGAGACCAACATCCCCACCGTCGGCCAGCAGGGCTTCAGCATGGAGAAGATCATCCTCTGGAGC
ACCTGCCGCACCGACGACAAGCCACTGACGGCCGACGAGAAGCTGGCCGTCCGCTTCCTCGAGCGCTGCATGGAG
CTCGACCCCTCGAGGAGGATCACGGCCGACCAGGCCCTGGAGCACGACTTCCTGCGCGCCGCCGACTTGCCCGGC
CGGGAGCTGGGCGACGACGACGAGATGGACATGCTCGAGACGTAA
Gene >Hirsu2|7159
ATGACGGCCAACGACCACCGTCACGCCCCAGAGCCCTTCGAGATCCACGAGGATGCTCGGACCGAGGAGACGGTC
GTCATGGCCGAGGACGAGACCGGGGCTGACAACTTGACCTCCGCCGTCGACGCGGGAGCTGCAGAGCACGACGTT
CTGGCCAATGAAGACGGAGAGGAGGCCACGGTCGATATGCAAGGGACGGAGGAGCTGGACGGGACCATAGGGGAC
GCGGAAGAGGTGCGCGAGGAGATCGATTTCGACCAAGAGGAAGAGCACGAGGAGGAAGGCGGGCACGGCAAGGAT
AATGATGAAGACGAGGACGAAGACGCCGACGCCGACAACGACGACGACGACGACGACGATGACGACGACGACGAG
AGTTCCGACGACGATCAGGTCGAGAGCAGCGTCCAAGCCGACATGGACAAGTTACAGGGAGACTTTCCAGGCTTC
CGCGACAAGTATCGCTTGATCAAACGCATCGGCGAAGGTTTGGCTACCGGGCTGCCGCGGGAGAGAAGGGCTTGA
GGCTGACCTTGTCGCTACAGGTACTTTCTCGACCGTCTTCAAGGCCGAAGACATACACTACAACCGCTACGACAA
CAGCTGGGACTTGCAGGACGGTCCGTCCAAGTGGACGCCTCCGCCGCTCAGGAAACGCCCGCACGCGGCGAGCCA
GCCGCTGCGGCGGCGCCCGCGATACGTTGCCATCAAGAAGATCTACGTCACGTCGAGTCCGGCCCGGATCCTCAA
CGAGCTCGAGCTTCTCCACGACCTCCGTCAGTGCCCGTCCGTCTGCCCGCTCATCACGGCCTTCCGCCACACTGA
CCAGGTGGTGGCCATACTGCCCTACTTCCGCCACGGCGACTTCCGTACCTACTTCCGCGACATGACCATCCCGGA
CATCGCCATCTACCTGCGCTCCCTCTTCACCGCCCTCAGCAGCGTCCACGCCAGCAAGATCCTGCACCGCGACAT
CAAGCCCACAAACTTCCTCTACGACCCGGCCTCGCAGCACGGCGTCCTCGTCGACTTCGGCCTGGCCGAGCGCGA
GGGCTCCGACTGCCGGCCCTGCCTCTGTCACGAGCCGCGCGAGGTCCGCAAGCTGCGCCAGGCCAACTCGGTCTG
GGCCCAGTCCACTGCCGCGTCGCAGCCTGGCTACCCCAAGTCCGACACGCGGCCCTCGCGTCGCGCCAACCGTGC
CGGCACCAGGGGCTTCCGCGCCCCCGAGGTGCTCTTCAAGTGCACCGAGCAGACGACGGCCATCGACATCTGGTC
CGTCGGCGTCATCCTCCTCACCATCCTGTCCAAGCGCTTCCCCTTCTTCAACTCGGCCGACGACGTCGAGGCCAT
GATTGAGATAGCCACCATCTTCGGCTCCAAGCGGATGAAGGCCGCCGGCCTCCTGCACGGCTGCGTCTTCGAGAC
CAACATCCCCACCGTCGGCCAGCAGGGCTTCAGCATGGAGAAGATCATCCTCTGGAGCACCTGCCGCACCGACGA
CAAGCCACTGACGGCCGACGAGAAGCTGGCCGTCCGCTTCCTCGAGCGCTGCATGGAGCTCGACCCCTCGAGGAG
GATCACGGCCGACCAGGCCCTGGAGCACGACTTCCTGCGCGCCGCCGACTTGCCCGGCCGGGAGCTGGGCGACGA
CGACGAGATGGACATGCTCGAGACGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail