Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|7149
Gene name
LocationContig_40:13146..15066
Strand-
Gene length (bp)1920
Transcript length (bp)1815
Coding sequence length (bp)1815
Protein length (aa) 605

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01565 FAD_binding_4 FAD binding domain 1.6E-25 129 269
PF08031 BBE Berberine and berberine like 1.7E-08 513 547

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|D4AS41|A7056_ARTBC Uncharacterized FAD-linked oxidoreductase ARB_02478 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_07056 PE=1 SV=2 36 571 5.0E-88
sp|D4B1Z7|A2478_ARTBC Uncharacterized FAD-linked oxidoreductase ARB_02478 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_02478 PE=1 SV=1 37 559 1.0E-65
sp|P08159|HDNO_ARTOX 6-hydroxy-D-nicotine oxidase OS=Arthrobacter oxydans PE=1 SV=2 129 333 9.0E-18
sp|A3AVP1|CKX8_ORYSJ Cytokinin dehydrogenase 8 OS=Oryza sativa subsp. japonica GN=CKX8 PE=3 SV=1 160 311 4.0E-09
sp|A2XVN3|CKX8_ORYSI Cytokinin dehydrogenase 8 OS=Oryza sativa subsp. indica GN=CKX8 PE=3 SV=1 160 311 4.0E-09
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|D4AS41|A7056_ARTBC Uncharacterized FAD-linked oxidoreductase ARB_02478 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_07056 PE=1 SV=2 36 571 5.0E-88
sp|D4B1Z7|A2478_ARTBC Uncharacterized FAD-linked oxidoreductase ARB_02478 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_02478 PE=1 SV=1 37 559 1.0E-65
sp|P08159|HDNO_ARTOX 6-hydroxy-D-nicotine oxidase OS=Arthrobacter oxydans PE=1 SV=2 129 333 9.0E-18
sp|A3AVP1|CKX8_ORYSJ Cytokinin dehydrogenase 8 OS=Oryza sativa subsp. japonica GN=CKX8 PE=3 SV=1 160 311 4.0E-09
sp|A2XVN3|CKX8_ORYSI Cytokinin dehydrogenase 8 OS=Oryza sativa subsp. indica GN=CKX8 PE=3 SV=1 160 311 4.0E-09
sp|D4B1P2|A2372_ARTBC Uncharacterized FAD-linked oxidoreductase ARB_02372 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_02372 PE=1 SV=1 241 309 7.0E-08
sp|Q9LTS3|CKX3_ARATH Cytokinin dehydrogenase 3 OS=Arabidopsis thaliana GN=CKX3 PE=1 SV=1 137 298 2.0E-07
sp|P43485|MCRA_STRLA Mitomycin radical oxidase OS=Streptomyces lavendulae GN=mcrA PE=1 SV=2 130 376 3.0E-07
sp|O06997|YVDP_BACSU Uncharacterized FAD-linked oxidoreductase YvdP OS=Bacillus subtilis (strain 168) GN=yvdP PE=1 SV=1 242 550 5.0E-07
sp|Q796Y5|YGAK_BACSU Uncharacterized FAD-linked oxidoreductase YgaK OS=Bacillus subtilis (strain 168) GN=ygaK PE=3 SV=4 124 550 7.0E-07
sp|D7UQ40|SOL5_ALTSO Bifunctional solanapyrone synthase OS=Alternaria solani GN=sol5 PE=1 SV=1 241 309 1.0E-06
sp|Q8LNV6|CKX3_ORYSJ Cytokinin dehydrogenase 3 OS=Oryza sativa subsp. japonica GN=CKX3 PE=2 SV=1 200 297 7.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016491 oxidoreductase activity Yes
GO:0055114 oxidation-reduction process Yes
GO:0050660 flavin adenine dinucleotide binding Yes
GO:1901265 nucleoside phosphate binding No
GO:0050662 coenzyme binding No
GO:0005488 binding No
GO:0003824 catalytic activity No
GO:0043168 anion binding No
GO:0003674 molecular_function No
GO:0097159 organic cyclic compound binding No
GO:0043167 ion binding No
GO:0000166 nucleotide binding No
GO:0036094 small molecule binding No
GO:0008150 biological_process No
GO:0048037 cofactor binding No
GO:1901363 heterocyclic compound binding No
GO:0008152 metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 23 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|7149
MIFYSTAAALALAGSVLAKAYGSPGPVGDGSSSSSCKCFPGDDCWPGPAEWARLNETVHGRLVATVPLGSPCHDP
NYDEGACLALRRRWSYPSIHTASSSSVMAPLFSNLSCDPFQPRDSPCLLGNYVRYAVEARCAEDIIDTLRFADEH
NVRFVIRNTGHDFQGRSTGAGALSVWTHRLKDMELLDWADKRYTGKALKVGAGVVTFEALEFAQKAGLVVITGQC
FSVGLAGGYIQGGGHSALSSRYGLAADNALSYEVVTPSGRLVTASPSEHPDLYWALSGGGGGNFGVVVSATVKAH
PDARVAGASWDVGLPEGNEDALLEAVDAFHASLPKLIESGIMVVYSFGRKFVKGISMTAYNMTKAEAQQALQPFS
EAVGSLGLRLTANFTEFRNYYEHLSHYFGPAPDGNIMVGVALYGGRLIPRQALARFAPTARRLVGLDATFIGVGL
DVSRFGSRMANAVLPQWREATVHAAVSRPWTPGAPLEQMQAEQDRITRVIQPVLEAATPGSGAYMNEADFQQPDF
QDVFFGANYPRLLRIKRKYDGRGLLYATAGVGSEDWDVHRDGRMCRRRSRSGKEDDTYGPGERHDARPRGSDWVP
STSR*
Coding >Hirsu2|7149
ATGATCTTCTACTCGACAGCCGCCGCGCTGGCACTTGCCGGCTCCGTCCTCGCCAAGGCTTACGGGTCGCCCGGG
CCCGTCGGCGACGGCAGCAGCAGCAGCAGCTGTAAATGTTTTCCCGGAGACGACTGCTGGCCAGGCCCGGCCGAG
TGGGCGCGGCTCAACGAGACGGTCCACGGCCGGCTCGTGGCGACGGTGCCACTCGGGTCTCCCTGCCACGACCCC
AACTACGACGAGGGCGCCTGCTTGGCCCTCCGCCGGCGGTGGTCATACCCGTCTATCCACACTGCGTCTTCTTCC
TCGGTCATGGCGCCTCTGTTCTCCAACCTGAGCTGCGATCCCTTCCAGCCCCGGGACTCGCCTTGCCTGTTGGGC
AACTACGTGAGATACGCCGTCGAGGCCCGCTGCGCAGAGGACATTATTGATACCCTAAGGTTCGCCGATGAACAT
AACGTTCGCTTTGTGATCCGCAATACCGGCCATGACTTTCAAGGCCGGTCTACGGGCGCCGGAGCCCTCTCGGTA
TGGACCCATCGCCTGAAGGATATGGAGCTTCTGGACTGGGCCGACAAGCGCTATACGGGCAAAGCCCTCAAAGTA
GGCGCCGGCGTGGTGACGTTCGAGGCTCTGGAGTTTGCCCAAAAGGCCGGCCTAGTCGTGATCACGGGCCAGTGC
TTCTCTGTTGGCCTTGCGGGAGGCTATATACAAGGCGGCGGCCACTCGGCCTTGAGTAGCAGGTACGGCTTGGCG
GCCGACAACGCGCTGAGTTACGAAGTGGTGACGCCCTCGGGGCGTCTTGTCACCGCATCGCCATCCGAGCACCCT
GACCTATACTGGGCCCTAAGCGGCGGAGGAGGCGGCAATTTCGGCGTCGTCGTCTCCGCCACAGTCAAGGCCCAT
CCCGACGCCCGCGTGGCCGGCGCGTCCTGGGATGTCGGGCTTCCGGAAGGGAACGAGGATGCGCTGCTCGAGGCC
GTCGATGCCTTCCACGCCTCGCTGCCGAAGCTGATCGAATCCGGGATCATGGTCGTCTACTCGTTTGGCCGCAAG
TTCGTCAAGGGCATCAGCATGACGGCCTACAACATGACCAAGGCCGAGGCGCAACAGGCTCTGCAGCCGTTCAGC
GAAGCCGTCGGATCGCTGGGCCTCCGCCTGACGGCCAACTTTACCGAGTTCCGCAACTACTACGAGCATCTCAGC
CACTACTTCGGGCCCGCGCCCGACGGCAACATAATGGTCGGCGTGGCGCTGTACGGCGGGCGCCTGATTCCACGA
CAGGCCCTGGCCCGCTTCGCGCCGACGGCGCGCAGGCTGGTCGGGCTGGATGCGACCTTCATCGGGGTCGGTCTC
GACGTGTCCCGTTTCGGGTCCAGGATGGCCAACGCGGTGCTGCCCCAGTGGCGCGAAGCCACGGTACACGCGGCC
GTGTCCCGCCCGTGGACACCGGGGGCGCCCCTGGAGCAGATGCAGGCTGAGCAAGACAGGATCACGAGGGTGATT
CAGCCGGTGCTGGAGGCGGCCACACCCGGCTCGGGCGCGTACATGAACGAGGCTGACTTCCAGCAGCCCGACTTC
CAAGACGTCTTTTTCGGGGCAAACTACCCGAGGCTGCTGAGGATCAAGAGGAAATACGACGGGCGCGGGCTCCTG
TACGCGACGGCCGGCGTGGGGAGCGAGGACTGGGACGTGCATAGGGATGGGCGGATGTGCCGCCGACGATCCAGA
TCCGGCAAAGAGGACGACACGTACGGCCCGGGCGAGAGACATGACGCGAGGCCCCGGGGCTCCGATTGGGTGCCG
TCGACGAGCAGATAG
Transcript >Hirsu2|7149
ATGATCTTCTACTCGACAGCCGCCGCGCTGGCACTTGCCGGCTCCGTCCTCGCCAAGGCTTACGGGTCGCCCGGG
CCCGTCGGCGACGGCAGCAGCAGCAGCAGCTGTAAATGTTTTCCCGGAGACGACTGCTGGCCAGGCCCGGCCGAG
TGGGCGCGGCTCAACGAGACGGTCCACGGCCGGCTCGTGGCGACGGTGCCACTCGGGTCTCCCTGCCACGACCCC
AACTACGACGAGGGCGCCTGCTTGGCCCTCCGCCGGCGGTGGTCATACCCGTCTATCCACACTGCGTCTTCTTCC
TCGGTCATGGCGCCTCTGTTCTCCAACCTGAGCTGCGATCCCTTCCAGCCCCGGGACTCGCCTTGCCTGTTGGGC
AACTACGTGAGATACGCCGTCGAGGCCCGCTGCGCAGAGGACATTATTGATACCCTAAGGTTCGCCGATGAACAT
AACGTTCGCTTTGTGATCCGCAATACCGGCCATGACTTTCAAGGCCGGTCTACGGGCGCCGGAGCCCTCTCGGTA
TGGACCCATCGCCTGAAGGATATGGAGCTTCTGGACTGGGCCGACAAGCGCTATACGGGCAAAGCCCTCAAAGTA
GGCGCCGGCGTGGTGACGTTCGAGGCTCTGGAGTTTGCCCAAAAGGCCGGCCTAGTCGTGATCACGGGCCAGTGC
TTCTCTGTTGGCCTTGCGGGAGGCTATATACAAGGCGGCGGCCACTCGGCCTTGAGTAGCAGGTACGGCTTGGCG
GCCGACAACGCGCTGAGTTACGAAGTGGTGACGCCCTCGGGGCGTCTTGTCACCGCATCGCCATCCGAGCACCCT
GACCTATACTGGGCCCTAAGCGGCGGAGGAGGCGGCAATTTCGGCGTCGTCGTCTCCGCCACAGTCAAGGCCCAT
CCCGACGCCCGCGTGGCCGGCGCGTCCTGGGATGTCGGGCTTCCGGAAGGGAACGAGGATGCGCTGCTCGAGGCC
GTCGATGCCTTCCACGCCTCGCTGCCGAAGCTGATCGAATCCGGGATCATGGTCGTCTACTCGTTTGGCCGCAAG
TTCGTCAAGGGCATCAGCATGACGGCCTACAACATGACCAAGGCCGAGGCGCAACAGGCTCTGCAGCCGTTCAGC
GAAGCCGTCGGATCGCTGGGCCTCCGCCTGACGGCCAACTTTACCGAGTTCCGCAACTACTACGAGCATCTCAGC
CACTACTTCGGGCCCGCGCCCGACGGCAACATAATGGTCGGCGTGGCGCTGTACGGCGGGCGCCTGATTCCACGA
CAGGCCCTGGCCCGCTTCGCGCCGACGGCGCGCAGGCTGGTCGGGCTGGATGCGACCTTCATCGGGGTCGGTCTC
GACGTGTCCCGTTTCGGGTCCAGGATGGCCAACGCGGTGCTGCCCCAGTGGCGCGAAGCCACGGTACACGCGGCC
GTGTCCCGCCCGTGGACACCGGGGGCGCCCCTGGAGCAGATGCAGGCTGAGCAAGACAGGATCACGAGGGTGATT
CAGCCGGTGCTGGAGGCGGCCACACCCGGCTCGGGCGCGTACATGAACGAGGCTGACTTCCAGCAGCCCGACTTC
CAAGACGTCTTTTTCGGGGCAAACTACCCGAGGCTGCTGAGGATCAAGAGGAAATACGACGGGCGCGGGCTCCTG
TACGCGACGGCCGGCGTGGGGAGCGAGGACTGGGACGTGCATAGGGATGGGCGGATGTGCCGCCGACGATCCAGA
TCCGGCAAAGAGGACGACACGTACGGCCCGGGCGAGAGACATGACGCGAGGCCCCGGGGCTCCGATTGGGTGCCG
TCGACGAGCAGATAG
Gene >Hirsu2|7149
ATGATCTTCTACTCGACAGCCGCCGCGCTGGCACTTGCCGGCTCCGTCCTCGCCAAGGCTTACGGGTCGCCCGGG
CCCGTCGGCGACGGCAGCAGCAGCAGCAGCTGTAAATGTTTTCCCGGAGACGACTGCTGGCCAGGCCCGGCCGAG
TGGGCGCGGCTCAACGAGACGGTCCACGGCCGGCTCGTGGCGACGGTGCCACTCGGGTCTCCCTGCCACGACCCC
AACTACGACGAGGGCGCCTGCTTGGCCCTCCGCCGGCGGTGGTCATACCCGTCTATCCAGTGAGTTTCGGATGCA
ACCCTTCTGCCCTTTTTGGCGGAGGGGAACTCGCCGAAAGACAGGCTTCCGGAAGGGCCAGGTGGGCTGACACGG
AGGTTTCCCGTCAGCACTGCGTCTTCTTCCTCGGTCATGGCGCCTCTGTTCTCCAACCTGAGCTGCGATCCCTTC
CAGCCCCGGGACTCGCCTTGCCTGTTGGGCAACTACGTGAGATACGCCGTCGAGGCCCGCTGCGCAGAGGACATT
ATTGATACCCTAAGGTTCGCCGATGAACATAACGTTCGCTTTGTGATCCGCAATACCGGCCATGACTTTCAAGGC
CGGTCTACGGGCGCCGGAGCCCTCTCGGTATGGACCCATCGCCTGAAGGATATGGAGCTTCTGGACTGGGCCGAC
AAGCGCTATACGGGCAAAGCCCTCAAAGTAGGCGCCGGCGTGGTGACGTTCGAGGCTCTGGAGTTTGCCCAAAAG
GCCGGCCTAGTCGTGATCACGGGCCAGTGCTTCTCTGTTGGCCTTGCGGGAGGCTATATACAAGGCGGCGGCCAC
TCGGCCTTGAGTAGCAGGTACGGCTTGGCGGCCGACAACGCGCTGAGTTACGAAGTGGTGACGCCCTCGGGGCGT
CTTGTCACCGCATCGCCATCCGAGCACCCTGACCTATACTGGGCCCTAAGCGGCGGAGGAGGCGGCAATTTCGGC
GTCGTCGTCTCCGCCACAGTCAAGGCCCATCCCGACGCCCGCGTGGCCGGCGCGTCCTGGGATGTCGGGCTTCCG
GAAGGGAACGAGGATGCGCTGCTCGAGGCCGTCGATGCCTTCCACGCCTCGCTGCCGAAGCTGATCGAATCCGGG
ATCATGGTCGTCTACTCGTTTGGCCGCAAGTTCGTCAAGGGCATCAGCATGACGGCCTACAACATGACCAAGGCC
GAGGCGCAACAGGCTCTGCAGCCGTTCAGCGAAGCCGTCGGATCGCTGGGCCTCCGCCTGACGGCCAACTTTACC
GAGTTCCGCAACTACTACGAGCATCTCAGCCACTACTTCGGGCCCGCGCCCGACGGCAACATAATGGTCGGCGTG
GCGCTGTACGGCGGGCGCCTGATTCCACGACAGGCCCTGGCCCGCTTCGCGCCGACGGCGCGCAGGCTGGTCGGG
CTGGATGCGACCTTCATCGGGGTCGGTCTCGACGTGTCCCGTTTCGGGTCCAGGATGGCCAACGCGGTGCTGCCC
CAGTGGCGCGAAGCCACGGTACACGCGGCCGTGTCCCGCCCGTGGACACCGGGGGCGCCCCTGGAGCAGATGCAG
GCTGAGCAAGACAGGATCACGAGGGTGATTCAGCCGGTGCTGGAGGCGGCCACACCCGGCTCGGGCGCGTACATG
AACGAGGCTGACTTCCAGCAGCCCGACTTCCAAGACGTCTTTTTCGGGGCAAACTACCCGAGGCTGCTGAGGATC
AAGAGGAAATACGACGGGCGCGGGCTCCTGTACGCGACGGCCGGCGTGGGGAGCGAGGACTGGGACGTGCATAGG
GATGGGCGGATGTGCCGCCGACGATCCAGATCCGGCAAAGAGGACGACACGTACGGCCCGGGCGAGAGACATGAC
GCGAGGCCCCGGGGCTCCGATTGGGTGCCGTCGACGAGCAGATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail