Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|7147
Gene name
LocationContig_40:7651..10157
Strand+
Gene length (bp)2506
Transcript length (bp)1935
Coding sequence length (bp)1935
Protein length (aa) 645

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07732 Cu-oxidase_3 Multicopper oxidase 1.0E-38 95 217
PF07731 Cu-oxidase_2 Multicopper oxidase 1.1E-30 515 628
PF00394 Cu-oxidase Multicopper oxidase 6.4E-14 238 365

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P14133|ASO_CUCSA L-ascorbate oxidase OS=Cucumis sativus PE=1 SV=1 86 642 4.0E-51
sp|Q0JHP8|LAC8_ORYSJ Laccase-8 OS=Oryza sativa subsp. japonica GN=LAC8 PE=3 SV=2 109 627 2.0E-40
sp|Q02079|LAC3_THACU Laccase-3 OS=Thanatephorus cucumeris GN=LCC3 PE=2 SV=1 87 625 2.0E-39
sp|Q12541|LAC1_AGABI Laccase-1 OS=Agaricus bisporus GN=lcc1 PE=1 SV=1 91 625 1.0E-37
sp|Q40588|ASO_TOBAC L-ascorbate oxidase OS=Nicotiana tabacum GN=AAO PE=2 SV=1 87 378 9.0E-37
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P14133|ASO_CUCSA L-ascorbate oxidase OS=Cucumis sativus PE=1 SV=1 86 642 4.0E-51
sp|Q0JHP8|LAC8_ORYSJ Laccase-8 OS=Oryza sativa subsp. japonica GN=LAC8 PE=3 SV=2 109 627 2.0E-40
sp|Q02079|LAC3_THACU Laccase-3 OS=Thanatephorus cucumeris GN=LCC3 PE=2 SV=1 87 625 2.0E-39
sp|Q12541|LAC1_AGABI Laccase-1 OS=Agaricus bisporus GN=lcc1 PE=1 SV=1 91 625 1.0E-37
sp|Q40588|ASO_TOBAC L-ascorbate oxidase OS=Nicotiana tabacum GN=AAO PE=2 SV=1 87 378 9.0E-37
sp|Q941X2|LAC3_ORYSJ Laccase-3 OS=Oryza sativa subsp. japonica GN=LAC3 PE=2 SV=1 109 629 3.0E-36
sp|P24792|ASO_CUCMA L-ascorbate oxidase OS=Cucurbita maxima GN=AAO PE=1 SV=2 90 377 8.0E-36
sp|P37064|ASO_CUCPM L-ascorbate oxidase OS=Cucurbita pepo var. melopepo PE=1 SV=1 90 377 3.0E-35
sp|Q84J37|LAC15_ARATH Laccase-15 OS=Arabidopsis thaliana GN=TT10 PE=1 SV=1 90 629 3.0E-34
sp|Q02081|LAC4_THACU Laccase-4 OS=Thanatephorus cucumeris GN=LCC4 PE=1 SV=1 93 365 3.0E-33
sp|Q96WM9|LAC2_BOTFU Laccase-2 OS=Botryotinia fuckeliana GN=lcc2 PE=2 SV=1 65 372 3.0E-33
sp|Q69L99|LAC14_ORYSJ Laccase-14 OS=Oryza sativa subsp. japonica GN=LAC14 PE=3 SV=1 104 629 1.0E-32
sp|Q99056|LAC5_TRAVI Laccase-5 OS=Trametes villosa GN=LCC5 PE=3 SV=2 95 372 2.0E-32
sp|Q96UM2|LAC3_BOTFU Laccase-3 (Fragment) OS=Botryotinia fuckeliana GN=lcc3 PE=3 SV=1 117 626 2.0E-31
sp|Q02075|LAC2_THACU Laccase-2 OS=Thanatephorus cucumeris GN=LCC2 PE=2 SV=1 87 337 2.0E-31
sp|A2XCN6|LAC18_ORYSI Putative laccase-18 OS=Oryza sativa subsp. indica GN=LAC18 PE=3 SV=1 109 629 3.0E-31
sp|P56193|LAC1_THACU Laccase-1 OS=Thanatephorus cucumeris GN=LCC1 PE=1 SV=1 87 365 5.0E-31
sp|Q53LU4|LAC18_ORYSJ Laccase-18 OS=Oryza sativa subsp. japonica GN=LAC18 PE=2 SV=1 109 629 6.0E-31
sp|Q12717|LAC5_TRAVE Laccase-5 OS=Trametes versicolor GN=LCC5 PE=2 SV=1 95 372 3.0E-30
sp|Q12719|LAC4_TRAVE Laccase-4 OS=Trametes versicolor GN=LCC4 PE=3 SV=1 95 364 4.0E-29
sp|Q9SU40|SKU5_ARATH Monocopper oxidase-like protein SKU5 OS=Arabidopsis thaliana GN=SKU5 PE=1 SV=1 85 627 1.0E-28
sp|P78722|LAC2_PODAS Laccase-2 OS=Podospora anserina GN=LAC2 PE=2 SV=1 70 365 2.0E-28
sp|Q99055|LAC4_TRAVI Laccase-4 OS=Trametes villosa GN=LCC4 PE=3 SV=1 95 364 2.0E-28
sp|Q03966|LAC1_CRYPA Laccase OS=Cryphonectria parasitica GN=LAC-1 PE=3 SV=1 95 372 3.0E-28
sp|D0VWU3|LAC1_TRAMX Laccase OS=Trametes maxima PE=1 SV=1 95 372 2.0E-27
sp|Q01679|LAC1_PHLRA Laccase OS=Phlebia radiata GN=LAC PE=1 SV=2 93 364 4.0E-27
sp|Q02497|LAC1_TRAHI Laccase OS=Trametes hirsuta PE=1 SV=1 95 336 4.0E-27
sp|P06811|LAC1_NEUCR Laccase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=lacc PE=1 SV=3 87 365 6.0E-27
sp|Q12542|LAC2_AGABI Laccase-2 OS=Agaricus bisporus GN=lcc2 PE=1 SV=1 91 383 6.0E-27
sp|Q99044|LAC1_TRAVI Laccase-1 OS=Trametes villosa GN=LCC1 PE=3 SV=1 95 336 1.0E-26
sp|Q99049|LAC3_TRAVI Laccase-3 OS=Trametes villosa GN=LCC3 PE=3 SV=1 101 339 5.0E-26
sp|I6WZK7|MMCO_MYCTU Multicopper oxidase MmcO OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=mmcO PE=1 SV=1 104 626 6.0E-26
sp|Q70KY3|LAC1_MELAO Laccase-1 OS=Melanocarpus albomyces GN=LAC1 PE=1 SV=1 57 365 2.0E-25
sp|Q12570|LAC1_BOTFU Laccase-1 OS=Botryotinia fuckeliana GN=lcc1 PE=2 SV=3 95 364 4.0E-25
sp|O59896|LAC1_PYCCI Laccase OS=Pycnoporus cinnabarinus GN=LCC3-1 PE=1 SV=1 95 336 2.0E-24
sp|Q12718|LAC2_TRAVE Laccase-2 OS=Trametes versicolor GN=LCC2 PE=1 SV=1 95 337 3.0E-24
sp|Q09920|FIO1_SCHPO Iron transport multicopper oxidase fio1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=fio1 PE=3 SV=1 91 371 8.0E-24
sp|Q6Z8L2|LAC9_ORYSJ Putative laccase-9 OS=Oryza sativa subsp. japonica GN=LAC9 PE=3 SV=1 107 375 2.0E-23
sp|Q99046|LAC2_TRAVI Laccase-2 OS=Trametes villosa GN=LCC2 PE=3 SV=1 95 337 2.0E-23
sp|Q12729|LAC1_PLEOS Laccase-1 OS=Pleurotus ostreatus GN=POX1 PE=2 SV=1 95 372 3.0E-23
sp|Q9FLB5|LAC12_ARATH Laccase-12 OS=Arabidopsis thaliana GN=LAC12 PE=2 SV=1 112 364 7.0E-23
sp|Q12739|LAC2_PLEOS Laccase-2 OS=Pleurotus ostreatus GN=POX2 PE=1 SV=1 95 372 1.0E-22
sp|Q9LYQ2|LAC13_ARATH Laccase-13 OS=Arabidopsis thaliana GN=LAC13 PE=2 SV=1 112 364 2.0E-22
sp|Q9LFD1|LAC9_ARATH Laccase-9 OS=Arabidopsis thaliana GN=LAC9 PE=2 SV=1 107 364 2.0E-22
sp|P12374|COPA_PSEUB Copper resistance protein A OS=Pseudomonas syringae pv. tomato GN=copA PE=1 SV=1 112 621 4.0E-22
sp|Q5N9W4|LAC5_ORYSJ Putative laccase-5 OS=Oryza sativa subsp. japonica GN=LAC5 PE=3 SV=1 90 364 5.0E-22
sp|Q9FHN6|SKS2_ARATH Monocopper oxidase-like protein SKS2 OS=Arabidopsis thaliana GN=SKS2 PE=1 SV=1 101 337 2.0E-21
sp|P43561|FET5_YEAST Iron transport multicopper oxidase FET5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FET5 PE=1 SV=1 102 364 2.0E-21
sp|Q9SR40|LAC7_ARATH Laccase-7 OS=Arabidopsis thaliana GN=LAC7 PE=2 SV=1 107 373 2.0E-21
sp|Q5N7A3|LAC6_ORYSJ Laccase-6 OS=Oryza sativa subsp. japonica GN=LAC6 PE=2 SV=1 108 369 2.0E-21
sp|D4APX3|LAC1_ARTBC Laccase ARB_05828 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_05828 PE=1 SV=1 87 365 2.0E-21
sp|Q0IP28|LAC25_ORYSJ Laccase-25 OS=Oryza sativa subsp. japonica GN=LAC25 PE=3 SV=1 112 364 3.0E-21
sp|Q9ZPY2|LAC6_ARATH Laccase-6 OS=Arabidopsis thaliana GN=LAC6 PE=2 SV=1 109 364 3.0E-21
sp|Q9LFD2|LAC8_ARATH Laccase-8 OS=Arabidopsis thaliana GN=LAC8 PE=2 SV=1 113 364 4.0E-21
sp|Q2QZ80|LAC21_ORYSJ Laccase-21 OS=Oryza sativa subsp. japonica GN=LAC21 PE=2 SV=1 107 376 4.0E-21
sp|Q47452|PCOA_ECOLX Copper resistance protein A OS=Escherichia coli GN=pcoA PE=3 SV=1 112 365 4.0E-21
sp|Q2QUN2|LAC24_ORYSJ Laccase-24 OS=Oryza sativa subsp. japonica GN=LAC24 PE=2 SV=1 112 364 5.0E-21
sp|Q9SIY8|LAC5_ARATH Laccase-5 OS=Arabidopsis thaliana GN=LAC5 PE=2 SV=1 112 364 6.0E-21
sp|A2Y9C5|LAC19_ORYSI Putative laccase-19 OS=Oryza sativa subsp. indica GN=LAC19 PE=3 SV=1 109 364 7.0E-21
sp|Q339K6|LAC15_ORYSJ Laccase-15 OS=Oryza sativa subsp. japonica GN=LAC15 PE=2 SV=1 108 364 7.0E-21
sp|Q2R0L2|LAC19_ORYSJ Laccase-19 OS=Oryza sativa subsp. japonica GN=LAC19 PE=2 SV=1 109 364 7.0E-21
sp|Q56YT0|LAC3_ARATH Laccase-3 OS=Arabidopsis thaliana GN=LAC3 PE=2 SV=2 112 364 2.0E-20
sp|Q5ZCW1|LAC1_ORYSJ Putative laccase-1 OS=Oryza sativa subsp. japonica GN=LAC1 PE=3 SV=1 107 364 2.0E-20
sp|Q6CII3|FET3_KLULA Iron transport multicopper oxidase FET3 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=FET3 PE=3 SV=1 107 337 3.0E-20
sp|Q7XE50|LAC16_ORYSJ Putative laccase-16 OS=Oryza sativa subsp. japonica GN=LAC16 PE=5 SV=1 151 629 4.0E-20
sp|P78591|FET3_CANAX Iron transport multicopper oxidase FET3 OS=Candida albicans GN=FET3 PE=3 SV=1 98 274 8.0E-20
sp|Q96WT3|FET3_CANGA Iron transport multicopper oxidase FET3 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=FET3 PE=3 SV=1 93 337 9.0E-20
sp|A2Y9C2|LAC20_ORYSI Laccase-20 OS=Oryza sativa subsp. indica GN=LAC20 PE=3 SV=1 109 364 2.0E-19
sp|Q8VZA1|LAC11_ARATH Laccase-11 OS=Arabidopsis thaliana GN=LAC11 PE=2 SV=1 107 364 2.0E-19
sp|Q2R0L0|LAC20_ORYSJ Laccase-20 OS=Oryza sativa subsp. japonica GN=LAC20 PE=2 SV=1 109 364 2.0E-19
sp|Q8RYM9|LAC2_ORYSJ Laccase-2 OS=Oryza sativa subsp. japonica GN=LAC2 PE=2 SV=1 107 375 4.0E-19
sp|Q2QYS3|LAC23_ORYSJ Laccase-23 OS=Oryza sativa subsp. japonica GN=LAC23 PE=3 SV=1 107 364 5.0E-19
sp|P29162|ASOL_TOBAC L-ascorbate oxidase homolog OS=Nicotiana tabacum PE=2 SV=1 82 341 7.0E-19
sp|Q9FY79|LAC14_ARATH Laccase-14 OS=Arabidopsis thaliana GN=LAC14 PE=2 SV=1 109 364 9.0E-19
sp|P59571|COPA_PSESM Copper resistance protein A homolog OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=copA PE=3 SV=1 104 365 1.0E-18
sp|Q2RBK2|LAC17_ORYSJ Putative laccase-17 OS=Oryza sativa subsp. japonica GN=LAC17 PE=3 SV=1 109 364 2.0E-18
sp|Q00624|ASOL_BRANA L-ascorbate oxidase homolog OS=Brassica napus GN=Bp10 PE=2 SV=1 89 341 3.0E-18
sp|Q0DHL5|LAC11_ORYSJ Putative laccase-11 OS=Oryza sativa subsp. japonica GN=LAC11 PE=5 SV=2 105 381 4.0E-18
sp|O81081|LAC2_ARATH Laccase-2 OS=Arabidopsis thaliana GN=LAC2 PE=2 SV=1 107 365 6.0E-18
sp|Q5N9X2|LAC4_ORYSJ Laccase-4 OS=Oryza sativa subsp. japonica GN=LAC4 PE=2 SV=1 90 364 1.0E-17
sp|Q0DHL2|LAC12_ORYSJ Laccase-12/13 OS=Oryza sativa subsp. japonica GN=LAC12 PE=2 SV=1 107 364 2.0E-17
sp|P17489|LAC1_EMENI Laccase-1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=yA PE=2 SV=3 87 281 2.0E-17
sp|P38993|FET3_YEAST Iron transport multicopper oxidase FET3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FET3 PE=1 SV=2 100 337 3.0E-17
sp|Q5N7B4|LAC7_ORYSJ Laccase-7 OS=Oryza sativa subsp. japonica GN=LAC7 PE=2 SV=1 109 372 3.0E-17
sp|Q8VXX5|SKS1_ARATH Monocopper oxidase-like protein SKS1 OS=Arabidopsis thaliana GN=SKS1 PE=1 SV=1 89 337 4.0E-17
sp|Q1PDH6|LAC16_ARATH Laccase-16 OS=Arabidopsis thaliana GN=LAC16 PE=2 SV=2 107 373 5.0E-17
sp|P43561|FET5_YEAST Iron transport multicopper oxidase FET5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FET5 PE=1 SV=1 525 637 1.0E-16
sp|Q9FJD5|LAC17_ARATH Laccase-17 OS=Arabidopsis thaliana GN=LAC17 PE=2 SV=1 107 372 2.0E-16
sp|Q6CII3|FET3_KLULA Iron transport multicopper oxidase FET3 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=FET3 PE=3 SV=1 525 625 1.0E-15
sp|P78591|FET3_CANAX Iron transport multicopper oxidase FET3 OS=Candida albicans GN=FET3 PE=3 SV=1 522 625 2.0E-15
sp|Q5N7A3|LAC6_ORYSJ Laccase-6 OS=Oryza sativa subsp. japonica GN=LAC6 PE=2 SV=1 525 627 3.0E-15
sp|Q04399|GMC1_YEAST Putative multicopper oxidase GMC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GMC1 PE=1 SV=1 118 364 3.0E-15
sp|O80434|LAC4_ARATH Laccase-4 OS=Arabidopsis thaliana GN=IRX12 PE=2 SV=2 90 364 5.0E-15
sp|Q9LMS3|LAC1_ARATH Laccase-1 OS=Arabidopsis thaliana GN=LAC1 PE=2 SV=1 107 337 1.0E-14
sp|Q0IQU1|LAC22_ORYSJ Laccase-22 OS=Oryza sativa subsp. japonica GN=LAC22 PE=2 SV=2 90 364 2.0E-14
sp|P38993|FET3_YEAST Iron transport multicopper oxidase FET3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FET3 PE=1 SV=2 525 616 3.0E-14
sp|Q09920|FIO1_SCHPO Iron transport multicopper oxidase fio1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=fio1 PE=3 SV=1 522 625 4.0E-14
sp|Q96WT3|FET3_CANGA Iron transport multicopper oxidase FET3 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=FET3 PE=3 SV=1 522 625 6.0E-14
sp|Q5N7B4|LAC7_ORYSJ Laccase-7 OS=Oryza sativa subsp. japonica GN=LAC7 PE=2 SV=1 525 629 7.0E-14
sp|Q10ND7|LAC10_ORYSJ Laccase-10 OS=Oryza sativa subsp. japonica GN=LAC10 PE=2 SV=1 90 376 7.0E-14
sp|Q04399|GMC1_YEAST Putative multicopper oxidase GMC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GMC1 PE=1 SV=1 502 640 3.0E-13
sp|Q8RYM9|LAC2_ORYSJ Laccase-2 OS=Oryza sativa subsp. japonica GN=LAC2 PE=2 SV=1 525 629 6.0E-13
sp|Q03966|LAC1_CRYPA Laccase OS=Cryphonectria parasitica GN=LAC-1 PE=3 SV=1 537 622 1.0E-12
sp|Q70KY3|LAC1_MELAO Laccase-1 OS=Melanocarpus albomyces GN=LAC1 PE=1 SV=1 537 621 2.0E-12
sp|Q0IP28|LAC25_ORYSJ Laccase-25 OS=Oryza sativa subsp. japonica GN=LAC25 PE=3 SV=1 525 629 3.0E-12
sp|Q6Z8L2|LAC9_ORYSJ Putative laccase-9 OS=Oryza sativa subsp. japonica GN=LAC9 PE=3 SV=1 522 629 4.0E-12
sp|Q2QUN2|LAC24_ORYSJ Laccase-24 OS=Oryza sativa subsp. japonica GN=LAC24 PE=2 SV=1 506 627 5.0E-12
sp|Q8VZA1|LAC11_ARATH Laccase-11 OS=Arabidopsis thaliana GN=LAC11 PE=2 SV=1 525 627 6.0E-12
sp|Q339K6|LAC15_ORYSJ Laccase-15 OS=Oryza sativa subsp. japonica GN=LAC15 PE=2 SV=1 537 629 7.0E-12
sp|P06811|LAC1_NEUCR Laccase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=lacc PE=1 SV=3 537 621 8.0E-12
sp|Q0DHL5|LAC11_ORYSJ Putative laccase-11 OS=Oryza sativa subsp. japonica GN=LAC11 PE=5 SV=2 525 629 8.0E-12
sp|Q2QYS3|LAC23_ORYSJ Laccase-23 OS=Oryza sativa subsp. japonica GN=LAC23 PE=3 SV=1 437 629 1.0E-11
sp|Q2RBK2|LAC17_ORYSJ Putative laccase-17 OS=Oryza sativa subsp. japonica GN=LAC17 PE=3 SV=1 437 629 1.0E-11
sp|Q96WM9|LAC2_BOTFU Laccase-2 OS=Botryotinia fuckeliana GN=lcc2 PE=2 SV=1 524 622 2.0E-11
sp|Q12570|LAC1_BOTFU Laccase-1 OS=Botryotinia fuckeliana GN=lcc1 PE=2 SV=3 523 621 2.0E-11
sp|Q9LFD1|LAC9_ARATH Laccase-9 OS=Arabidopsis thaliana GN=LAC9 PE=2 SV=1 525 628 2.0E-11
sp|Q2QZ80|LAC21_ORYSJ Laccase-21 OS=Oryza sativa subsp. japonica GN=LAC21 PE=2 SV=1 522 629 2.0E-11
sp|Q0DHL2|LAC12_ORYSJ Laccase-12/13 OS=Oryza sativa subsp. japonica GN=LAC12 PE=2 SV=1 522 635 2.0E-11
sp|P78722|LAC2_PODAS Laccase-2 OS=Podospora anserina GN=LAC2 PE=2 SV=1 524 621 3.0E-11
sp|Q5N9W4|LAC5_ORYSJ Putative laccase-5 OS=Oryza sativa subsp. japonica GN=LAC5 PE=3 SV=1 525 629 3.0E-11
sp|Q6ID18|LAC10_ARATH Laccase-10 OS=Arabidopsis thaliana GN=LAC10 PE=2 SV=1 92 364 3.0E-11
sp|Q9LYQ2|LAC13_ARATH Laccase-13 OS=Arabidopsis thaliana GN=LAC13 PE=2 SV=1 536 629 7.0E-11
sp|O81081|LAC2_ARATH Laccase-2 OS=Arabidopsis thaliana GN=LAC2 PE=2 SV=1 525 629 7.0E-11
sp|Q9FJD5|LAC17_ARATH Laccase-17 OS=Arabidopsis thaliana GN=LAC17 PE=2 SV=1 525 629 7.0E-11
sp|Q9LFD2|LAC8_ARATH Laccase-8 OS=Arabidopsis thaliana GN=LAC8 PE=2 SV=1 525 629 8.0E-11
sp|Q0IQU1|LAC22_ORYSJ Laccase-22 OS=Oryza sativa subsp. japonica GN=LAC22 PE=2 SV=2 532 629 9.0E-11
sp|Q5ZCW1|LAC1_ORYSJ Putative laccase-1 OS=Oryza sativa subsp. japonica GN=LAC1 PE=3 SV=1 522 629 1.0E-10
sp|Q10ND7|LAC10_ORYSJ Laccase-10 OS=Oryza sativa subsp. japonica GN=LAC10 PE=2 SV=1 525 629 1.0E-10
sp|Q6ID18|LAC10_ARATH Laccase-10 OS=Arabidopsis thaliana GN=LAC10 PE=2 SV=1 531 629 1.0E-10
sp|Q56YT0|LAC3_ARATH Laccase-3 OS=Arabidopsis thaliana GN=LAC3 PE=2 SV=2 537 629 3.0E-10
sp|P37064|ASO_CUCPM L-ascorbate oxidase OS=Cucurbita pepo var. melopepo PE=1 SV=1 527 642 4.0E-10
sp|Q9FY79|LAC14_ARATH Laccase-14 OS=Arabidopsis thaliana GN=LAC14 PE=2 SV=1 537 636 5.0E-10
sp|Q5N9X2|LAC4_ORYSJ Laccase-4 OS=Oryza sativa subsp. japonica GN=LAC4 PE=2 SV=1 525 621 5.0E-10
sp|Q1PDH6|LAC16_ARATH Laccase-16 OS=Arabidopsis thaliana GN=LAC16 PE=2 SV=2 525 629 6.0E-10
sp|P24792|ASO_CUCMA L-ascorbate oxidase OS=Cucurbita maxima GN=AAO PE=1 SV=2 537 642 7.0E-10
sp|Q9FLB5|LAC12_ARATH Laccase-12 OS=Arabidopsis thaliana GN=LAC12 PE=2 SV=1 522 629 1.0E-09
sp|Q9ZPY2|LAC6_ARATH Laccase-6 OS=Arabidopsis thaliana GN=LAC6 PE=2 SV=1 522 629 1.0E-09
sp|Q9SIY8|LAC5_ARATH Laccase-5 OS=Arabidopsis thaliana GN=LAC5 PE=2 SV=1 522 627 1.0E-09
sp|O80434|LAC4_ARATH Laccase-4 OS=Arabidopsis thaliana GN=IRX12 PE=2 SV=2 525 629 1.0E-09
sp|Q40588|ASO_TOBAC L-ascorbate oxidase OS=Nicotiana tabacum GN=AAO PE=2 SV=1 537 642 1.0E-09
sp|A2Y9C5|LAC19_ORYSI Putative laccase-19 OS=Oryza sativa subsp. indica GN=LAC19 PE=3 SV=1 488 629 4.0E-09
sp|Q2R0L2|LAC19_ORYSJ Laccase-19 OS=Oryza sativa subsp. japonica GN=LAC19 PE=2 SV=1 488 629 4.0E-09
sp|Q9SR40|LAC7_ARATH Laccase-7 OS=Arabidopsis thaliana GN=LAC7 PE=2 SV=1 525 629 5.0E-09
sp|Q02075|LAC2_THACU Laccase-2 OS=Thanatephorus cucumeris GN=LCC2 PE=2 SV=1 537 635 8.0E-09
sp|D4APX3|LAC1_ARTBC Laccase ARB_05828 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_05828 PE=1 SV=1 537 627 1.0E-08
sp|A2Y9C2|LAC20_ORYSI Laccase-20 OS=Oryza sativa subsp. indica GN=LAC20 PE=3 SV=1 500 629 1.0E-08
sp|Q2R0L0|LAC20_ORYSJ Laccase-20 OS=Oryza sativa subsp. japonica GN=LAC20 PE=2 SV=1 500 629 1.0E-08
sp|Q9LMS3|LAC1_ARATH Laccase-1 OS=Arabidopsis thaliana GN=LAC1 PE=2 SV=1 522 629 1.0E-08
sp|Q99056|LAC5_TRAVI Laccase-5 OS=Trametes villosa GN=LCC5 PE=3 SV=2 537 624 2.0E-08
sp|Q12717|LAC5_TRAVE Laccase-5 OS=Trametes versicolor GN=LCC5 PE=2 SV=1 537 625 2.0E-08
sp|Q12729|LAC1_PLEOS Laccase-1 OS=Pleurotus ostreatus GN=POX1 PE=2 SV=1 537 625 3.0E-08
sp|Q01679|LAC1_PHLRA Laccase OS=Phlebia radiata GN=LAC PE=1 SV=2 537 632 4.0E-08
sp|Q12739|LAC2_PLEOS Laccase-2 OS=Pleurotus ostreatus GN=POX2 PE=1 SV=1 537 642 4.0E-08
sp|Q99055|LAC4_TRAVI Laccase-4 OS=Trametes villosa GN=LCC4 PE=3 SV=1 537 626 9.0E-08
sp|Q12719|LAC4_TRAVE Laccase-4 OS=Trametes versicolor GN=LCC4 PE=3 SV=1 537 626 1.0E-07
sp|Q12542|LAC2_AGABI Laccase-2 OS=Agaricus bisporus GN=lcc2 PE=1 SV=1 536 625 2.0E-07
sp|O59896|LAC1_PYCCI Laccase OS=Pycnoporus cinnabarinus GN=LCC3-1 PE=1 SV=1 535 625 1.0E-06
sp|Q12718|LAC2_TRAVE Laccase-2 OS=Trametes versicolor GN=LCC2 PE=1 SV=1 537 634 1.0E-06
sp|Q99046|LAC2_TRAVI Laccase-2 OS=Trametes villosa GN=LCC2 PE=3 SV=1 537 634 2.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016491 oxidoreductase activity Yes
GO:0005507 copper ion binding Yes
GO:0055114 oxidation-reduction process Yes
GO:0046872 metal ion binding No
GO:0008152 metabolic process No
GO:0043169 cation binding No
GO:0008150 biological_process No
GO:0043167 ion binding No
GO:0003674 molecular_function No
GO:0003824 catalytic activity No
GO:0046914 transition metal ion binding No
GO:0005488 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 19 0.5

Transmembrane Domains

Domain # Start End Length
1 20 42 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|7147
MSGPQRVAAAARRSRHGRLLATASLVSATACTAALLLYFTYYFSFGLARTAVVSKGRRPSSGSHGDGARNTDPFI
LHPERHIFREPRSIHLTWNVTKADRAPDGVVKAVYLINDQFPGPVIEARSGDELVVNVHNSVGGDGNEEERGISV
HWHGLFMKGANEMDGVVGLTQCAIPPSQNFTYRFRIDEQQSGTFWYHAHSGVQRADGLYGGLVVHKPVARTGPSA
SVLSPRPYEAEQLLLAGDWYHQPAGAVLDWFKDPNHYAYEPAPDSLLINGRGLFNCSMAVKARPVNCSAAERPTI
VLTGSRRVRLRVVNTGISSGYTISLTHGAMKVLSVDGDSLVSPRSPAAASVGVLYPGERMDVVVDRWASTDSEGR
SPELSILLDKENMKLHNFALTREQSFSVVWDDGYGDGKTASPGRQRGRRSPSLMHFNLAEASGTPLDASLAGMKR
PSETAVLYTTMQVRAASHNQPVGTVNHSSWAVADPGRRPLLSLDREEWAEAVTQPTPAQTFKTPWFGRAGPGGWL
ELVLNNFDDTGHPFHLHGYSFFVVSTGQSQPGQAAGYNPFDPAAASRVGPGNTANPLRKDTVYVPPMGYVVLRFR
LDNKGLWLLHCHVLWHQAIGMGAVLQVGDVAAGSRRRAAALCSR*
Coding >Hirsu2|7147
ATGTCTGGCCCGCAGAGGGTCGCCGCCGCCGCCCGACGCTCCCGGCACGGGCGGCTGTTGGCCACGGCCTCGTTG
GTCTCCGCCACTGCCTGCACCGCCGCCCTCCTCCTCTACTTCACCTATTACTTCTCCTTCGGCCTTGCCCGGACG
GCTGTCGTGTCCAAGGGCCGCCGGCCGTCGTCGGGGAGCCACGGAGACGGGGCCCGGAATACGGACCCCTTCATC
CTCCACCCCGAGAGGCACATCTTCCGCGAGCCCCGGAGTATCCACCTGACTTGGAATGTCACCAAGGCGGACCGG
GCGCCGGACGGTGTCGTGAAAGCCGTCTATCTGATCAACGATCAGTTCCCGGGTCCCGTCATCGAGGCCAGGTCG
GGCGACGAACTCGTCGTCAACGTGCACAACTCTGTCGGTGGCGATGGTAATGAAGAGGAGCGCGGCATCTCTGTG
CACTGGCATGGACTCTTCATGAAAGGGGCCAACGAAATGGACGGCGTCGTCGGACTGACACAATGCGCCATCCCT
CCGTCCCAGAACTTCACTTATCGCTTCCGGATAGACGAGCAGCAGTCCGGTACTTTCTGGTATCACGCCCACTCC
GGCGTGCAGCGCGCCGACGGGCTCTACGGCGGACTCGTCGTCCACAAGCCCGTCGCTCGGACCGGACCGTCCGCC
TCTGTCCTTTCACCGCGTCCGTACGAGGCCGAGCAGCTTCTTCTCGCCGGCGACTGGTACCACCAGCCAGCCGGC
GCCGTGCTGGACTGGTTCAAAGACCCGAACCACTATGCCTATGAGCCGGCTCCCGACTCCCTCCTGATTAACGGG
CGCGGTCTCTTCAACTGCTCCATGGCCGTTAAAGCACGTCCCGTCAACTGCAGCGCAGCCGAGAGGCCGACCATC
GTATTAACGGGCAGCCGACGTGTACGGCTCAGAGTTGTTAATACTGGCATATCATCTGGATACACCATTTCGCTC
ACACACGGGGCTATGAAGGTCCTCTCCGTAGACGGCGACAGCCTGGTCTCGCCCAGATCTCCGGCCGCGGCATCC
GTCGGTGTGCTCTACCCTGGCGAGAGGATGGACGTCGTCGTCGACCGCTGGGCATCCACCGATTCCGAAGGCCGA
TCTCCGGAGCTAAGTATTCTGCTTGACAAAGAGAACATGAAACTGCACAACTTCGCCCTTACCCGCGAGCAATCC
TTCTCTGTCGTCTGGGACGACGGCTACGGGGATGGGAAGACGGCAAGCCCGGGCCGGCAGCGCGGCCGACGCAGC
CCAAGCCTGATGCACTTCAACCTGGCAGAGGCATCAGGCACGCCGCTCGACGCTTCCTTGGCCGGCATGAAGAGA
CCATCGGAGACGGCCGTGCTATACACAACGATGCAGGTGCGGGCCGCGAGCCACAACCAGCCCGTCGGCACCGTC
AACCACAGCTCCTGGGCCGTCGCGGACCCAGGCCGCCGACCGCTCCTTTCCCTAGACCGGGAGGAGTGGGCGGAG
GCCGTGACGCAACCGACGCCGGCCCAGACCTTCAAGACCCCCTGGTTCGGAAGGGCCGGCCCGGGGGGTTGGCTG
GAGCTTGTGCTGAACAATTTTGACGACACGGGACATCCATTCCACCTGCATGGATACAGCTTCTTCGTCGTCTCG
ACGGGCCAGAGCCAGCCCGGGCAGGCGGCCGGTTACAACCCGTTTGACCCGGCGGCGGCGTCGCGGGTGGGGCCG
GGCAACACGGCCAACCCGCTGCGCAAGGACACAGTCTACGTGCCACCGATGGGCTATGTCGTACTCCGCTTCCGG
CTCGACAACAAGGGTTTATGGCTCCTGCACTGCCACGTACTCTGGCATCAGGCGATCGGCATGGGCGCTGTGCTC
CAAGTCGGCGACGTCGCGGCTGGGAGTCGACGGCGCGCGGCGGCCCTGTGTTCACGCTGA
Transcript >Hirsu2|7147
ATGTCTGGCCCGCAGAGGGTCGCCGCCGCCGCCCGACGCTCCCGGCACGGGCGGCTGTTGGCCACGGCCTCGTTG
GTCTCCGCCACTGCCTGCACCGCCGCCCTCCTCCTCTACTTCACCTATTACTTCTCCTTCGGCCTTGCCCGGACG
GCTGTCGTGTCCAAGGGCCGCCGGCCGTCGTCGGGGAGCCACGGAGACGGGGCCCGGAATACGGACCCCTTCATC
CTCCACCCCGAGAGGCACATCTTCCGCGAGCCCCGGAGTATCCACCTGACTTGGAATGTCACCAAGGCGGACCGG
GCGCCGGACGGTGTCGTGAAAGCCGTCTATCTGATCAACGATCAGTTCCCGGGTCCCGTCATCGAGGCCAGGTCG
GGCGACGAACTCGTCGTCAACGTGCACAACTCTGTCGGTGGCGATGGTAATGAAGAGGAGCGCGGCATCTCTGTG
CACTGGCATGGACTCTTCATGAAAGGGGCCAACGAAATGGACGGCGTCGTCGGACTGACACAATGCGCCATCCCT
CCGTCCCAGAACTTCACTTATCGCTTCCGGATAGACGAGCAGCAGTCCGGTACTTTCTGGTATCACGCCCACTCC
GGCGTGCAGCGCGCCGACGGGCTCTACGGCGGACTCGTCGTCCACAAGCCCGTCGCTCGGACCGGACCGTCCGCC
TCTGTCCTTTCACCGCGTCCGTACGAGGCCGAGCAGCTTCTTCTCGCCGGCGACTGGTACCACCAGCCAGCCGGC
GCCGTGCTGGACTGGTTCAAAGACCCGAACCACTATGCCTATGAGCCGGCTCCCGACTCCCTCCTGATTAACGGG
CGCGGTCTCTTCAACTGCTCCATGGCCGTTAAAGCACGTCCCGTCAACTGCAGCGCAGCCGAGAGGCCGACCATC
GTATTAACGGGCAGCCGACGTGTACGGCTCAGAGTTGTTAATACTGGCATATCATCTGGATACACCATTTCGCTC
ACACACGGGGCTATGAAGGTCCTCTCCGTAGACGGCGACAGCCTGGTCTCGCCCAGATCTCCGGCCGCGGCATCC
GTCGGTGTGCTCTACCCTGGCGAGAGGATGGACGTCGTCGTCGACCGCTGGGCATCCACCGATTCCGAAGGCCGA
TCTCCGGAGCTAAGTATTCTGCTTGACAAAGAGAACATGAAACTGCACAACTTCGCCCTTACCCGCGAGCAATCC
TTCTCTGTCGTCTGGGACGACGGCTACGGGGATGGGAAGACGGCAAGCCCGGGCCGGCAGCGCGGCCGACGCAGC
CCAAGCCTGATGCACTTCAACCTGGCAGAGGCATCAGGCACGCCGCTCGACGCTTCCTTGGCCGGCATGAAGAGA
CCATCGGAGACGGCCGTGCTATACACAACGATGCAGGTGCGGGCCGCGAGCCACAACCAGCCCGTCGGCACCGTC
AACCACAGCTCCTGGGCCGTCGCGGACCCAGGCCGCCGACCGCTCCTTTCCCTAGACCGGGAGGAGTGGGCGGAG
GCCGTGACGCAACCGACGCCGGCCCAGACCTTCAAGACCCCCTGGTTCGGAAGGGCCGGCCCGGGGGGTTGGCTG
GAGCTTGTGCTGAACAATTTTGACGACACGGGACATCCATTCCACCTGCATGGATACAGCTTCTTCGTCGTCTCG
ACGGGCCAGAGCCAGCCCGGGCAGGCGGCCGGTTACAACCCGTTTGACCCGGCGGCGGCGTCGCGGGTGGGGCCG
GGCAACACGGCCAACCCGCTGCGCAAGGACACAGTCTACGTGCCACCGATGGGCTATGTCGTACTCCGCTTCCGG
CTCGACAACAAGGGTTTATGGCTCCTGCACTGCCACGTACTCTGGCATCAGGCGATCGGCATGGGCGCTGTGCTC
CAAGTCGGCGACGTCGCGGCTGGGAGTCGACGGCGCGCGGCGGCCCTGTGTTCACGCTGA
Gene >Hirsu2|7147
ATGTCTGGCCCGCAGAGGGTCGCCGCCGCCGCCCGACGCTCCCGGCACGGGCGGCTGTTGGCCACGGCCTCGTTG
GTCTCCGCCACTGCCTGCACCGCCGCCCTCCTCCTCTACTTCACCTATTACTTCTCCTTCGGCCTTGCCCGGACG
GCTGTCGTGTCCAAGGGCCGCCGGCCGTCGTCGGGGAGCCACGGAGACGGGGCCCGGAATACGGACCCCTTCATC
CTCCACCCCGAGAGGCACATCTTCCGCGAGCCCCGGAGTATCCACCTGACTTGGAATGTCACCAAGGCGGACCGG
GCGCCGGACGGTGTCGTGAAAGCCGTCTATCTGATCAACGGTTGGTGCTCAGTCCAGATGTCTGAGCACGCAGCA
CACTGCGGGCGCGGACTGCGGCAAGGGTCTCGGCTGACGGCATTGACAGATCAGTTCCCGGGTCCCGTCATCGAG
GCCAGGTCGGGCGACGAACTCGTCGTCAACGTGCACAACTCTGTCGGTGGCGATGGTAATGAAGAGGAGCGCGGC
ATCTCTGTGCACTGGCATGGACTCTTCATGAAAGGTACGCAACCGCCTCCTCTGGTCTCGCAATCGGGATGGCAC
TGACATGAGGCAACCCGACCGTCATTGCATCCGCTCAAACAGGGGCCAACGAAATGGACGGCGTCGTCGGACTGA
CACAATGCGCCATCCCTCCGTCCCAGAACTTCACTTATCGCTTCCGGATAGACGAGCAGCAGTCCGGTACTTTCT
GGTATGGTCCCTTGTTGCCGACTCTGCTCCGCTCCCGCATCTCTCGTTCTCGCCCAGAGCGTCTACCGTACTGAG
ACCGCGGGTCGGCATTGCAGGTATCACGCCCACTCCGGCGTGCAGCGCGCCGACGGGCTCTACGGCGGACTCGTC
GTCCACAAGCCCGTCGCTCGGACCGGACCGTCCGCCTCTGTCCTTTCACCGCGTCCGTACGAGGCCGAGCAGCTT
CTTCTCGCCGGCGACTGGTACCACCAGCCAGCCGGCGCCGTGCTGGACTGGTTCAAAGACCCGAACCACTATGCC
TATGAGGTATGTCTCTCCCTCTCTGTGACTCCCACTGGCCTCGTGACTCTGAGTGCTCGGGGTCTTTGGAAGGGG
GGCAGACTGACGCGTTATCCTCGGTATGCTTCCAGCCGGCTCCCGACTCCCTCCTGATTAACGGGCGCGGTCTCT
TCAACTGCTCCATGGCCGTTAAAGCACGTCCCGTCAACTGCAGCGCAGCCGAGAGGCCGACCATCGTATTAACGG
GCAGCCGACGTGTACGGCTCAGAGTTGTTAATACTGGGTAAGGTCGAACGCCTTGATAGACGCCCGAGTTTCCCC
CATCGGACCGGCTGGCTGATTCGAGGCTTTGTGCAGCATATCATCTGGATACACCATTTCGCTCACACACGGGGC
TATGAAGGTCCTCTCCGTAGACGGCGACAGCCTGGTCTCGCCCAGATCTCCGGCCGCGGCATCCGTCGGTGTGCT
CTACCCTGGCGAGAGGATGGACGTCGTCGTCGACCGCTGGGCATCCACCGATTCCGAAGGCCGATCTCCGGAGCT
AAGTATTCTGCTTGACAAAGAGTAGGTACCTTGATGCGGGTGGTGGAGGACAAAGATTGGCTCGATCGACTAACA
GCCCCGCCCCTGACGTCAGGAACATGAAACTGCACAACTTCGCCCTTACCCGCGAGCAATCCTTCTCTGTCGTCT
GGGACGACGGCTACGGGGATGGGAAGACGGCAAGCCCGGGCCGGCAGCGCGGCCGACGCAGCCCAAGCCTGATGC
ACTTCAACCTGGCAGAGGCATCAGGCACGCCGCTCGACGCTTCCTTGGCCGGCATGAAGAGACCATCGGAGACGG
CCGTGCTATACACAACGATGCAGGTGCGGGCCGCGAGCCACAACCAGCCCGTCGGCACCGTCAACCACAGCTCCT
GGGCCGTCGCGGACCCAGGCCGCCGACCGCTCCTTTCCCTAGACCGGGAGGAGTGGGCGGAGGCCGTGACGCAAC
CGACGCCGGCCCAGACCTTCAAGACCCCCTGGTTCGGAAGGGCCGGCCCGGGGGGTTGGCTGGAGCTTGTGCTGA
ACAATTTTGACGACACGGGACATCCATTCCACCTGGTGAGTGCTGCTTCTGTTAAGCGCGTCAGCGGACGAACGT
GCTCACTCCATCATCCAAGCATGGATACAGCTTCTTCGTCGTCTCGACGGGCCAGAGCCAGCCCGGGCAGGCGGC
CGGTTACAACCCGTTTGACCCGGCGGCGGCGTCGCGGGTGGGGCCGGGCAACACGGCCAACCCGCTGCGCAAGGA
CACAGTCTACGTGCCACCGATGGGCTATGTCGTACTCCGCTTCCGGCTCGACAACAAGGGTTTATGGCTCCTGCA
CTGCCACGTACTCTGGCATCAGGCGATCGGCATGGGCGCTGTGCTCCAAGTCGGCGACGTCGCGGCTGGGAGTCG
ACGGCGCGCGGCGGCCCTGTGTTCACGCTGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail