Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|714
Gene name
LocationContig_1145:2508..8018
Strand-
Gene length (bp)5510
Transcript length (bp)5376
Coding sequence length (bp)5376
Protein length (aa) 1792

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03142 Chitin_synth_2 Chitin synthase 9.8E-229 1058 1565
PF00173 Cyt-b5 Cytochrome b5-like Heme/Steroid binding domain 8.1E-12 813 883
PF08766 DEK_C DEK C terminal domain 2.4E-14 1735 1788
PF13632 Glyco_trans_2_3 Glycosyl transferase family group 2 1.1E-13 1250 1481
PF13641 Glyco_tranf_2_3 Glycosyltransferase like family 2 9.5E-11 1233 1412

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O13395|CHS6_USTMA Chitin synthase 6 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=CHS6 PE=3 SV=2 675 1700 0.0E+00
sp|Q4P9K9|CHS8_USTMA Chitin synthase 8 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=CHS8 PE=3 SV=1 490 1565 0.0E+00
sp|O13356|CHS1_CRYNH Chitin synthase 1 OS=Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) GN=CHS1 PE=3 SV=2 1082 1565 4.0E-145
sp|O13353|CHS4_MAGO7 Chitin synthase 4 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=CHS4 PE=3 SV=2 1083 1565 1.0E-139
sp|P78611|CHSD_EMENI Chitin synthase D OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=chsD PE=3 SV=4 1084 1565 1.0E-135
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O13395|CHS6_USTMA Chitin synthase 6 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=CHS6 PE=3 SV=2 675 1700 0.0E+00
sp|Q4P9K9|CHS8_USTMA Chitin synthase 8 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=CHS8 PE=3 SV=1 490 1565 0.0E+00
sp|O13356|CHS1_CRYNH Chitin synthase 1 OS=Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) GN=CHS1 PE=3 SV=2 1082 1565 4.0E-145
sp|O13353|CHS4_MAGO7 Chitin synthase 4 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=CHS4 PE=3 SV=2 1083 1565 1.0E-139
sp|P78611|CHSD_EMENI Chitin synthase D OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=chsD PE=3 SV=4 1084 1565 1.0E-135
sp|Q01285|CHS4_NEUCR Chitin synthase 4 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=chs-4 PE=3 SV=3 1083 1615 1.0E-135
sp|Q4P333|CHS7_USTMA Chitin synthase 7 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=CHS7 PE=3 SV=1 1080 1565 2.0E-135
sp|P29465|CHS3_YEAST Chitin synthase 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CHS3 PE=1 SV=3 1084 1565 2.0E-134
sp|P30573|CHS3_CANAX Chitin synthase 3 OS=Candida albicans GN=CHS3 PE=3 SV=1 1087 1560 3.0E-133
sp|J9VXM5|CHS3_CRYNH Chitin synthase 3 OS=Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) GN=CHS3 PE=3 SV=1 1084 1565 1.0E-132
sp|O13394|CHS5_USTMA Chitin synthase 5 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=CHS5 PE=3 SV=3 1084 1565 2.0E-126
sp|Q8SSI7|CHS1_ENCCU Chitin synthase 1 OS=Encephalitozoon cuniculi (strain GB-M1) GN=CHS1 PE=2 SV=1 1020 1535 2.0E-125
sp|P30598|CHS1_USTMA Chitin synthase 1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=CHS1 PE=3 SV=3 1248 1450 7.0E-16
sp|P48017|CHS_SAPMO Chitin synthase OS=Saprolegnia monoica GN=CHS PE=3 SV=1 1248 1416 8.0E-13
sp|P54267|CHSG_ASPFU Chitin synthase G OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=chsG PE=2 SV=2 1248 1515 1.0E-12
sp|P04341|NODC_RHIME N-acetylglucosaminyltransferase OS=Rhizobium meliloti (strain 1021) GN=nodC PE=3 SV=1 1248 1529 2.0E-11
sp|P29070|CHS1_NEUCR Chitin synthase 1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=chs-1 PE=3 SV=2 1248 1428 2.0E-11
sp|Q00757|CHSB_EMENI Chitin synthase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=chsB PE=2 SV=2 1248 1425 3.0E-11
sp|Q07755|NODC_AZOC5 N-acetylglucosaminyltransferase OS=Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / NBRC 14845 / NCIMB 13405 / ORS 571) GN=nodC PE=3 SV=2 1248 1427 3.0E-11
sp|P78746|CHSD_ASPFU Chitin synthase D OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=chsD PE=3 SV=1 1249 1533 3.0E-11
sp|Q12564|CHSA_AMPQU Chitin synthase A OS=Ampelomyces quisqualis GN=CHSA PE=3 SV=1 1112 1420 4.0E-11
sp|Q99127|CHS4_USTMA Chitin synthase 4 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=CHS4 PE=3 SV=2 1251 1516 8.0E-11
sp|P30599|CHS2_USTMA Chitin synthase 2 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=CHS2 PE=3 SV=2 1251 1416 1.0E-10
sp|P30583|CHSC_EMENI Chitin synthase C OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=chsC PE=3 SV=3 1112 1420 2.0E-10
sp|P26024|NODC_BRADU N-acetylglucosaminyltransferase OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=nodC PE=3 SV=2 1248 1557 2.0E-10
sp|Q92197|CHSC_ASPFU Chitin synthase C OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=chsC PE=3 SV=2 1112 1416 4.0E-10
sp|P30601|CHS2_EXODE Chitin synthase 2 OS=Exophiala dermatitidis GN=CHS2 PE=3 SV=2 1112 1420 4.0E-10
sp|P30600|CHS1_EXODE Chitin synthase 1 OS=Exophiala dermatitidis GN=CHS1 PE=3 SV=2 1251 1425 9.0E-10
sp|P30602|CHS3_EXODE Chitin synthase 3 OS=Exophiala dermatitidis GN=CHS3 PE=3 SV=2 1248 1545 1.0E-09
sp|Q99126|CHS3_USTMA Chitin synthase 3 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=CHS3 PE=3 SV=2 1251 1530 2.0E-09
sp|P17862|NODC_RHILO N-acetylglucosaminyltransferase OS=Rhizobium loti (strain MAFF303099) GN=nodC PE=3 SV=2 1248 1529 2.0E-09
sp|P23316|CHS1_CANAX Chitin synthase 1 OS=Candida albicans GN=CHS1 PE=2 SV=2 1242 1413 2.0E-09
sp|P78611|CHSD_EMENI Chitin synthase D OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=chsD PE=3 SV=4 743 1070 3.0E-09
sp|P30595|CHS2_RHIOL Chitin synthase 2 OS=Rhizopus oligosporus GN=CHS2 PE=3 SV=1 1242 1416 4.0E-09
sp|O13356|CHS1_CRYNH Chitin synthase 1 OS=Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) GN=CHS1 PE=3 SV=2 746 1071 5.0E-09
sp|P14180|CHS2_YEAST Chitin synthase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CHS2 PE=1 SV=1 1252 1416 5.0E-09
sp|P50356|NODC_RHIGA N-acetylglucosaminyltransferase OS=Rhizobium galegae GN=nodC PE=3 SV=1 1238 1418 6.0E-09
sp|P04340|NODC_RHILV N-acetylglucosaminyltransferase OS=Rhizobium leguminosarum bv. viciae GN=nodC PE=3 SV=1 1248 1418 8.0E-09
sp|O00219|HYAS3_HUMAN Hyaluronan synthase 3 OS=Homo sapiens GN=HAS3 PE=2 SV=3 1074 1414 1.0E-08
sp|P29465|CHS3_YEAST Chitin synthase 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CHS3 PE=1 SV=3 744 851 2.0E-08
sp|P30584|CHSA_EMENI Chitin synthase A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=chsA PE=3 SV=2 1251 1425 2.0E-08
sp|P50357|NODC_RHISN N-acetylglucosaminyltransferase OS=Rhizobium sp. (strain NGR234) GN=nodC PE=3 SV=2 1238 1418 2.0E-08
sp|P72334|NODC_RHIS3 N-acetylglucosaminyltransferase OS=Rhizobium sp. (strain N33) GN=nodC PE=3 SV=1 1248 1547 3.0E-08
sp|P87073|CHS1_PHYB8 Chitin synthase 1 OS=Phycomyces blakesleeanus (strain ATCC 8743b / FGSC 10004 / NBRC 33097 / NRRL 1555) GN=chs1 PE=3 SV=1 1251 1416 4.0E-08
sp|O35776|HYAS2_RAT Hyaluronan synthase 2 OS=Rattus norvegicus GN=Has2 PE=2 SV=1 1072 1414 5.0E-08
sp|P30588|CHS3_NEUCR Chitin synthase 3 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=chs-3 PE=3 SV=2 1112 1416 5.0E-08
sp|P30589|CHS2_NEUCR Chitin synthase 2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=chs-2 PE=3 SV=4 1251 1425 7.0E-08
sp|P08004|CHS1_YEAST Chitin synthase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CHS1 PE=1 SV=2 1252 1492 9.0E-08
sp|P30573|CHS3_CANAX Chitin synthase 3 OS=Candida albicans GN=CHS3 PE=3 SV=1 735 1070 1.0E-07
sp|O57424|HYAS2_CHICK Hyaluronan synthase 2 OS=Gallus gallus GN=HAS2 PE=2 SV=2 1072 1414 1.0E-07
sp|O08650|HYAS3_MOUSE Hyaluronan synthase 3 OS=Mus musculus GN=Has3 PE=1 SV=2 1061 1414 2.0E-07
sp|P70312|HYAS2_MOUSE Hyaluronan synthase 2 OS=Mus musculus GN=Has2 PE=1 SV=4 1072 1414 3.0E-07
sp|Q92444|CHS2_PARBR Chitin synthase 2 OS=Paracoccidioides brasiliensis GN=CHS2 PE=3 SV=2 1251 1425 5.0E-07
sp|P30597|CHS1_SCHPO Chitin synthase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=chs1 PE=3 SV=2 1248 1416 5.0E-07
sp|Q92819|HYAS2_HUMAN Hyaluronan synthase 2 OS=Homo sapiens GN=HAS2 PE=2 SV=1 1072 1414 6.0E-07
sp|G5AY81|HYAS2_HETGA Hyaluronan synthase 2 OS=Heterocephalus glaber GN=Has2 PE=3 SV=1 1072 1414 6.0E-07
sp|O57427|HYAS2_XENLA Hyaluronan synthase 2 OS=Xenopus laevis GN=has2 PE=2 SV=2 1248 1414 9.0E-07
sp|O97711|HYAS2_BOVIN Hyaluronan synthase 2 OS=Bos taurus GN=HAS2 PE=2 SV=1 1072 1414 1.0E-06
sp|P30594|CHS1_RHIOL Chitin synthase 1 OS=Rhizopus oligosporus GN=CHS1 PE=3 SV=1 1251 1416 1.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 21 0.45

Transmembrane Domains

Domain # Start End Length
1 743 765 22
2 778 800 22
3 1043 1065 22
4 1438 1460 22
5 1470 1492 22
6 1499 1521 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|714
MANRMSIFSASSDSPGSSRAGGPQTAQVSTTTLLNAAHNIYLSSQAHQLDVSTSLVVNTWLTASRGGPTVDASLA
ARAWEHARRRAEDGCVILGSLHQSTPSVLGPFLSSFPFATPSSLHNALEAVQPFVRCITPYNPSMPRQAALGVTL
TLNLSGDLTAASLALSQGGIDTVNGLLKIPPEAGYRAFDVFYYLLTSASTPAEREFLGLRSPSTYALLARSGTYN
PPPYLPTADDAASADDFRQALKNIGIKGSAHRNFISTLAGLLKLGNTLDYSIESETLAEICDDVSGLLGLEPETL
LSHCSTQDRWTFVGGLYESLVDWVISKANEAVATQMERIKAGDESLDGRAARSSVSNEDNGDTVSITVIEIPRTT
LGKALCMRSIFDDFHGINAEMIEDGVQASPAGSSVLREMQQAVSEVAPDLGIMTGPEGRERQFELEKREQVLEKI
ALAAEDGGFLKKLLFPILGEGINLGHAGRLDLPAVLASNRLWYHLCLHPTDDSPAQLAALPSVTSAWSAGTVSRQ
LRSWRLPEWANRRNRNLDFTTDFDVDEFVQRYSGLGCSDGRDGIENWMLERGWSNGEVFIGKERVWMRESAWWEA
ESMLDLKPGNSNAGAQGPHGNPFGSAFDTGYSIGGTGYFPSQAMDANFNGSNASNDQLLNARNFSQGNISQMTLN
PNPHPAPSIAHTTTRQVSNGDYGLGTKGDTYKGDVYYNEDGEFTGTMDPELAKNKHIQTKPVTFGRRVWVWIVWA
LTFWIPSPLLRFIGRMRRPDVRMAWREKLVLCFVIFLINAIIIFWIIGFGRLLCPNFDKAWSEREVGLHKGEDDF
WVSIHGKVYDISKFWRRQHSDTDIKTTSDNMMPLAGLDMDGYFPVPLSSACQGLGLKETTRLLANNTPEFPNAIH
TSGFFQPNPTSALHRSDWYWTNFEPTIKQYYHGDLVHSQSFVESAGKDTQRMWARYDDKIYDLTDYFHTLDLANT
DANKFLHVKVSDLWKNNPGQNIKDSLDGVIRDSNSDSTEHAKIMNSWLCIQRAFYKGMTDFRETPRCTVNNWILL
AFTIIVCAVVLIKFVSALRFSSKRRPSPQDKFVICQVPAYTEGEDSLRKALDSLTALQYDNKRKLICVICDGVIV
GQGNDRPTPKIVLDILGVDPKVDPPALPFKSVGPGSEQLNYGKVYSGLYEYEGNVVPYLVVVKVGKESEQTRPKP
GNRGKRDSQILLMSFLNRVHHRAPMSPLELEMFHQVNNIIGVDPELYEYLLMVDADTSVSEDSLNRLVSACAHNA
KIAGICGETSLENDEKSWTTMIQVYEYFISHHLAKAFESLFGSVTCLPGCFSMYRLRTADKGKPLIISDAVIKDY
SICDVDTLHQKNLLSLGEDRYLTTLMTKYFPYMAYKFVPDAQCKTAAPESWSVLVSQRRRWINSTIHNLVELMRL
EEMCGFCCFSMRFVVFIDLFGTIILPATCVYLVYLIYLVASKTGQFPLISIVMLAAVYGLQALVFILKRQWQHIG
WMIIYIIAFPIYSFILPVYSFWNQDNFTWGNTRVVIGEKGSKQVVAVDDEGFDPRSIPLQRWDDYALANNLPGRR
GGYQEKHDFGYGYGDQYEMDEIKSIYSAAPQGSVLTGMGGGRNTFMPPQSPAIGANRASTITPGLHHDAAASLRR
QSMMSMGNAMHDIQRSQSPYQDFPAGRPCMMNTRSMSNLSPALGLPANRSTSALGYTAGHRPPLGTDPMRSTSSF
DFQRGHTSADDMAIVEAIQSVLREVDLDTVTKKQVRALVEQRLQTELVGERRTFMDRQIDRELENM*
Coding >Hirsu2|714
ATGGCGAACCGAATGTCCATCTTCTCGGCCTCCTCCGACTCACCCGGCAGCTCGCGAGCAGGCGGGCCTCAGACT
GCCCAGGTGTCGACCACCACCCTTCTGAACGCCGCCCACAACATCTATCTGTCTTCTCAGGCCCACCAGCTGGAT
GTCAGCACCTCGCTCGTCGTCAATACGTGGCTGACGGCCTCCCGAGGCGGCCCGACTGTCGACGCATCGCTGGCT
GCTAGGGCATGGGAGCATGCTCGTCGACGCGCTGAAGACGGCTGTGTCATCTTGGGCTCACTTCACCAGTCGACA
CCGTCTGTCCTGGGCCCCTTCCTTTCTAGCTTCCCGTTCGCTACACCCTCCAGCCTCCACAATGCTCTGGAGGCT
GTCCAACCCTTCGTTCGATGCATCACGCCTTACAACCCATCCATGCCGAGACAAGCTGCTCTCGGTGTCACCCTT
ACATTGAATCTGTCTGGAGACCTCACCGCTGCTTCGCTTGCCCTGTCCCAGGGCGGCATCGACACCGTCAATGGT
TTGCTCAAGATTCCGCCAGAGGCCGGCTATCGCGCCTTCGACGTCTTCTACTATCTCCTCACGTCTGCTTCAACC
CCTGCCGAGCGAGAATTTCTCGGGCTGCGGAGTCCCTCCACCTACGCACTCCTGGCTCGATCGGGCACTTACAAC
CCGCCCCCCTACCTGCCCACGGCGGATGATGCTGCCTCGGCCGATGATTTTCGACAGGCCCTCAAAAACATTGGA
ATCAAGGGCTCCGCTCACCGCAACTTCATCTCGACTCTCGCCGGCCTGCTAAAGCTTGGCAATACACTCGATTAT
AGCATCGAGTCCGAGACGTTGGCGGAAATATGCGATGATGTCAGTGGTCTTCTGGGTCTCGAGCCAGAGACTCTG
CTCAGTCACTGTAGCACCCAGGACCGCTGGACCTTTGTGGGCGGTCTCTACGAGTCTCTTGTCGATTGGGTTATA
TCCAAAGCCAACGAGGCCGTGGCTACCCAAATGGAACGAATCAAGGCCGGCGACGAGTCACTCGATGGTCGTGCA
GCGAGATCGTCAGTCTCCAACGAGGACAACGGAGACACGGTATCTATCACCGTCATTGAGATCCCCCGGACCACC
CTTGGCAAGGCCTTGTGTATGCGTTCCATCTTCGACGACTTCCACGGCATCAACGCCGAGATGATCGAGGACGGC
GTACAAGCCTCGCCTGCAGGCTCATCTGTCTTGCGCGAGATGCAACAGGCCGTGTCCGAGGTCGCCCCTGATCTG
GGTATCATGACGGGGCCGGAAGGCAGGGAACGACAGTTCGAGCTCGAGAAAAGAGAGCAAGTGCTCGAGAAGATT
GCCCTTGCCGCGGAAGATGGCGGCTTCTTGAAAAAGCTACTCTTTCCTATCCTGGGCGAGGGCATCAATCTCGGT
CATGCCGGGAGGCTTGACTTGCCTGCCGTGCTGGCCTCAAACCGCCTGTGGTATCACCTCTGCCTTCATCCGACT
GATGATTCTCCCGCACAGCTCGCTGCTCTCCCGTCCGTCACCTCGGCTTGGTCGGCCGGCACAGTCTCCCGTCAA
CTGCGCTCCTGGAGGCTTCCCGAGTGGGCAAATCGACGAAACAGGAACCTGGACTTCACAACTGATTTTGACGTG
GATGAATTTGTTCAGCGCTACTCGGGCCTTGGATGCAGTGATGGGAGAGACGGCATCGAGAACTGGATGCTTGAG
CGTGGATGGAGCAATGGCGAGGTCTTCATTGGTAAAGAGCGCGTTTGGATGAGAGAGAGCGCTTGGTGGGAAGCG
GAAAGCATGCTGGATCTCAAGCCGGGAAACAGCAATGCCGGTGCTCAAGGCCCCCACGGAAATCCCTTCGGGTCC
GCTTTTGATACAGGCTATTCTATCGGTGGAACAGGTTATTTCCCCTCCCAGGCAATGGACGCGAACTTCAACGGC
AGCAACGCAAGCAACGATCAGCTACTCAATGCCCGCAACTTCAGTCAGGGCAACATTAGCCAAATGACTCTGAAC
CCCAATCCTCACCCGGCACCTTCTATCGCGCACACCACGACGCGCCAGGTTAGCAATGGAGACTACGGCCTCGGT
ACAAAGGGAGACACGTACAAAGGTGACGTGTACTATAACGAAGACGGTGAGTTCACGGGCACCATGGATCCGGAA
CTGGCCAAGAACAAGCACATACAGACGAAGCCGGTGACGTTCGGTCGTCGGGTCTGGGTATGGATTGTGTGGGCC
CTCACTTTTTGGATTCCCTCACCCTTACTCCGGTTCATTGGCCGGATGCGACGTCCGGACGTTCGTATGGCCTGG
CGAGAGAAGCTTGTACTATGTTTTGTCATCTTCCTCATCAACGCTATCATCATATTTTGGATCATCGGCTTCGGG
CGACTTCTGTGCCCCAACTTCGACAAAGCCTGGAGTGAACGGGAAGTTGGCCTCCACAAGGGCGAGGATGACTTT
TGGGTCAGCATTCATGGCAAGGTGTACGATATATCCAAGTTTTGGAGGCGCCAGCATAGCGATACGGACATCAAG
ACGACTAGCGACAACATGATGCCATTGGCCGGTCTCGACATGGACGGATACTTCCCAGTGCCTCTGAGCTCGGCA
TGCCAGGGTCTTGGGCTCAAAGAGACTACGCGTCTGCTGGCTAACAACACACCTGAGTTTCCCAATGCGATCCAC
ACTTCTGGCTTCTTCCAGCCGAACCCTACCAGCGCTCTGCACAGGTCTGATTGGTACTGGACCAACTTTGAGCCC
ACCATCAAGCAGTACTACCACGGTGATCTTGTCCACAGCCAAAGCTTCGTCGAGTCCGCTGGCAAGGACACGCAG
CGGATGTGGGCCAGGTACGACGACAAGATCTATGACTTAACCGACTACTTTCACACTCTGGACCTCGCCAATACC
GATGCGAACAAGTTCCTGCATGTCAAGGTCAGCGATCTATGGAAGAACAATCCCGGTCAGAACATCAAGGACTCG
CTTGATGGCGTAATTCGTGACTCGAATTCCGATTCCACTGAACATGCCAAGATCATGAACAGTTGGCTCTGCATT
CAGAGGGCCTTCTACAAGGGCATGACTGATTTTCGGGAAACGCCAAGGTGTACTGTCAACAACTGGATATTACTG
GCCTTCACAATCATTGTTTGTGCCGTCGTCCTCATCAAGTTCGTGTCGGCCCTCAGGTTCAGTTCCAAACGTCGT
CCGTCGCCGCAGGATAAATTTGTTATTTGCCAAGTCCCGGCATACACAGAAGGCGAGGACTCGTTGCGCAAGGCG
CTAGATTCGCTGACCGCCTTGCAATACGACAATAAAAGAAAGCTTATTTGCGTCATATGCGACGGCGTCATCGTC
GGTCAGGGCAACGATAGGCCTACTCCAAAGATCGTGCTGGACATTCTTGGGGTCGATCCAAAAGTCGACCCTCCT
GCCCTCCCGTTCAAGTCTGTGGGCCCCGGCAGCGAGCAGCTTAATTACGGCAAAGTCTATTCTGGTCTCTACGAA
TACGAGGGCAACGTCGTCCCATATCTGGTTGTGGTCAAGGTCGGCAAGGAATCCGAACAAACGAGGCCCAAGCCT
GGCAACCGCGGAAAGCGAGATTCTCAGATCCTTCTAATGAGCTTCCTCAACCGCGTTCATCATCGTGCTCCTATG
AGCCCACTGGAGCTGGAAATGTTTCACCAAGTTAACAACATTATCGGTGTGGATCCCGAGCTCTATGAGTACCTG
CTTATGGTGGACGCCGATACCTCGGTTAGTGAAGATTCGCTGAATCGACTCGTCTCTGCATGTGCGCACAACGCG
AAGATTGCCGGGATATGTGGTGAGACGAGTCTGGAGAATGACGAAAAGTCGTGGACCACGATGATTCAGGTCTAC
GAGTATTTTATCTCGCATCACCTGGCAAAAGCCTTCGAGTCACTGTTCGGCAGCGTCACATGTTTGCCCGGATGC
TTTTCAATGTATCGGCTGCGAACGGCTGATAAAGGCAAACCGCTCATCATCTCGGATGCCGTAATTAAGGATTAC
AGCATCTGTGACGTCGACACTCTCCACCAGAAGAATTTGCTATCGCTTGGCGAGGATCGTTACCTGACGACGCTG
ATGACTAAATACTTTCCCTATATGGCATATAAGTTTGTTCCAGATGCTCAGTGCAAGACGGCTGCGCCCGAGTCT
TGGAGTGTTCTGGTGTCGCAACGGCGGCGCTGGATCAACTCCACCATCCACAATCTCGTCGAGCTAATGCGCCTT
GAGGAAATGTGTGGCTTCTGCTGCTTCAGCATGCGTTTTGTCGTTTTCATCGACCTCTTCGGCACGATCATTCTC
CCAGCCACGTGCGTTTATCTCGTATACCTCATCTACTTGGTTGCGTCGAAAACCGGCCAATTTCCACTCATCTCT
ATCGTTATGCTGGCAGCTGTGTACGGCCTGCAGGCGCTTGTCTTTATCCTCAAGCGGCAATGGCAGCATATCGGG
TGGATGATCATATACATCATAGCCTTCCCCATCTATTCCTTCATATTGCCCGTCTACTCCTTCTGGAACCAGGAC
AACTTCACGTGGGGAAACACCCGTGTTGTCATCGGCGAGAAGGGCAGCAAACAAGTCGTCGCCGTCGATGATGAA
GGCTTCGACCCTCGGTCCATCCCACTTCAGCGCTGGGACGACTATGCCCTTGCCAACAACCTGCCCGGGCGCCGT
GGAGGTTACCAGGAAAAGCACGACTTCGGGTACGGGTATGGCGACCAGTACGAAATGGATGAGATCAAGTCCATC
TATTCGGCAGCGCCCCAGGGCTCCGTCCTGACGGGCATGGGCGGTGGTCGCAATACTTTCATGCCCCCGCAGTCT
CCTGCTATTGGAGCCAACCGCGCCTCTACCATCACTCCTGGACTACATCACGATGCCGCCGCGTCTCTGCGCCGG
CAATCGATGATGTCGATGGGCAACGCCATGCATGACATACAGAGGAGCCAGTCGCCTTATCAAGACTTCCCCGCC
GGTCGACCCTGCATGATGAACACGCGCAGCATGTCCAATCTCTCTCCGGCCTTGGGCCTCCCCGCCAACCGCTCG
ACCTCGGCGCTCGGTTATACGGCTGGTCACCGTCCGCCGCTGGGCACTGATCCCATGCGATCCACGTCGTCGTTT
GACTTCCAGCGCGGCCACACCAGCGCAGACGACATGGCCATTGTGGAGGCCATCCAATCCGTTCTCCGTGAAGTC
GACCTCGACACAGTCACGAAGAAGCAGGTGCGCGCTCTCGTCGAGCAACGCTTGCAGACCGAATTGGTCGGCGAG
CGACGAACCTTCATGGATCGGCAAATCGATCGCGAATTGGAGAATATGTGA
Transcript >Hirsu2|714
ATGGCGAACCGAATGTCCATCTTCTCGGCCTCCTCCGACTCACCCGGCAGCTCGCGAGCAGGCGGGCCTCAGACT
GCCCAGGTGTCGACCACCACCCTTCTGAACGCCGCCCACAACATCTATCTGTCTTCTCAGGCCCACCAGCTGGAT
GTCAGCACCTCGCTCGTCGTCAATACGTGGCTGACGGCCTCCCGAGGCGGCCCGACTGTCGACGCATCGCTGGCT
GCTAGGGCATGGGAGCATGCTCGTCGACGCGCTGAAGACGGCTGTGTCATCTTGGGCTCACTTCACCAGTCGACA
CCGTCTGTCCTGGGCCCCTTCCTTTCTAGCTTCCCGTTCGCTACACCCTCCAGCCTCCACAATGCTCTGGAGGCT
GTCCAACCCTTCGTTCGATGCATCACGCCTTACAACCCATCCATGCCGAGACAAGCTGCTCTCGGTGTCACCCTT
ACATTGAATCTGTCTGGAGACCTCACCGCTGCTTCGCTTGCCCTGTCCCAGGGCGGCATCGACACCGTCAATGGT
TTGCTCAAGATTCCGCCAGAGGCCGGCTATCGCGCCTTCGACGTCTTCTACTATCTCCTCACGTCTGCTTCAACC
CCTGCCGAGCGAGAATTTCTCGGGCTGCGGAGTCCCTCCACCTACGCACTCCTGGCTCGATCGGGCACTTACAAC
CCGCCCCCCTACCTGCCCACGGCGGATGATGCTGCCTCGGCCGATGATTTTCGACAGGCCCTCAAAAACATTGGA
ATCAAGGGCTCCGCTCACCGCAACTTCATCTCGACTCTCGCCGGCCTGCTAAAGCTTGGCAATACACTCGATTAT
AGCATCGAGTCCGAGACGTTGGCGGAAATATGCGATGATGTCAGTGGTCTTCTGGGTCTCGAGCCAGAGACTCTG
CTCAGTCACTGTAGCACCCAGGACCGCTGGACCTTTGTGGGCGGTCTCTACGAGTCTCTTGTCGATTGGGTTATA
TCCAAAGCCAACGAGGCCGTGGCTACCCAAATGGAACGAATCAAGGCCGGCGACGAGTCACTCGATGGTCGTGCA
GCGAGATCGTCAGTCTCCAACGAGGACAACGGAGACACGGTATCTATCACCGTCATTGAGATCCCCCGGACCACC
CTTGGCAAGGCCTTGTGTATGCGTTCCATCTTCGACGACTTCCACGGCATCAACGCCGAGATGATCGAGGACGGC
GTACAAGCCTCGCCTGCAGGCTCATCTGTCTTGCGCGAGATGCAACAGGCCGTGTCCGAGGTCGCCCCTGATCTG
GGTATCATGACGGGGCCGGAAGGCAGGGAACGACAGTTCGAGCTCGAGAAAAGAGAGCAAGTGCTCGAGAAGATT
GCCCTTGCCGCGGAAGATGGCGGCTTCTTGAAAAAGCTACTCTTTCCTATCCTGGGCGAGGGCATCAATCTCGGT
CATGCCGGGAGGCTTGACTTGCCTGCCGTGCTGGCCTCAAACCGCCTGTGGTATCACCTCTGCCTTCATCCGACT
GATGATTCTCCCGCACAGCTCGCTGCTCTCCCGTCCGTCACCTCGGCTTGGTCGGCCGGCACAGTCTCCCGTCAA
CTGCGCTCCTGGAGGCTTCCCGAGTGGGCAAATCGACGAAACAGGAACCTGGACTTCACAACTGATTTTGACGTG
GATGAATTTGTTCAGCGCTACTCGGGCCTTGGATGCAGTGATGGGAGAGACGGCATCGAGAACTGGATGCTTGAG
CGTGGATGGAGCAATGGCGAGGTCTTCATTGGTAAAGAGCGCGTTTGGATGAGAGAGAGCGCTTGGTGGGAAGCG
GAAAGCATGCTGGATCTCAAGCCGGGAAACAGCAATGCCGGTGCTCAAGGCCCCCACGGAAATCCCTTCGGGTCC
GCTTTTGATACAGGCTATTCTATCGGTGGAACAGGTTATTTCCCCTCCCAGGCAATGGACGCGAACTTCAACGGC
AGCAACGCAAGCAACGATCAGCTACTCAATGCCCGCAACTTCAGTCAGGGCAACATTAGCCAAATGACTCTGAAC
CCCAATCCTCACCCGGCACCTTCTATCGCGCACACCACGACGCGCCAGGTTAGCAATGGAGACTACGGCCTCGGT
ACAAAGGGAGACACGTACAAAGGTGACGTGTACTATAACGAAGACGGTGAGTTCACGGGCACCATGGATCCGGAA
CTGGCCAAGAACAAGCACATACAGACGAAGCCGGTGACGTTCGGTCGTCGGGTCTGGGTATGGATTGTGTGGGCC
CTCACTTTTTGGATTCCCTCACCCTTACTCCGGTTCATTGGCCGGATGCGACGTCCGGACGTTCGTATGGCCTGG
CGAGAGAAGCTTGTACTATGTTTTGTCATCTTCCTCATCAACGCTATCATCATATTTTGGATCATCGGCTTCGGG
CGACTTCTGTGCCCCAACTTCGACAAAGCCTGGAGTGAACGGGAAGTTGGCCTCCACAAGGGCGAGGATGACTTT
TGGGTCAGCATTCATGGCAAGGTGTACGATATATCCAAGTTTTGGAGGCGCCAGCATAGCGATACGGACATCAAG
ACGACTAGCGACAACATGATGCCATTGGCCGGTCTCGACATGGACGGATACTTCCCAGTGCCTCTGAGCTCGGCA
TGCCAGGGTCTTGGGCTCAAAGAGACTACGCGTCTGCTGGCTAACAACACACCTGAGTTTCCCAATGCGATCCAC
ACTTCTGGCTTCTTCCAGCCGAACCCTACCAGCGCTCTGCACAGGTCTGATTGGTACTGGACCAACTTTGAGCCC
ACCATCAAGCAGTACTACCACGGTGATCTTGTCCACAGCCAAAGCTTCGTCGAGTCCGCTGGCAAGGACACGCAG
CGGATGTGGGCCAGGTACGACGACAAGATCTATGACTTAACCGACTACTTTCACACTCTGGACCTCGCCAATACC
GATGCGAACAAGTTCCTGCATGTCAAGGTCAGCGATCTATGGAAGAACAATCCCGGTCAGAACATCAAGGACTCG
CTTGATGGCGTAATTCGTGACTCGAATTCCGATTCCACTGAACATGCCAAGATCATGAACAGTTGGCTCTGCATT
CAGAGGGCCTTCTACAAGGGCATGACTGATTTTCGGGAAACGCCAAGGTGTACTGTCAACAACTGGATATTACTG
GCCTTCACAATCATTGTTTGTGCCGTCGTCCTCATCAAGTTCGTGTCGGCCCTCAGGTTCAGTTCCAAACGTCGT
CCGTCGCCGCAGGATAAATTTGTTATTTGCCAAGTCCCGGCATACACAGAAGGCGAGGACTCGTTGCGCAAGGCG
CTAGATTCGCTGACCGCCTTGCAATACGACAATAAAAGAAAGCTTATTTGCGTCATATGCGACGGCGTCATCGTC
GGTCAGGGCAACGATAGGCCTACTCCAAAGATCGTGCTGGACATTCTTGGGGTCGATCCAAAAGTCGACCCTCCT
GCCCTCCCGTTCAAGTCTGTGGGCCCCGGCAGCGAGCAGCTTAATTACGGCAAAGTCTATTCTGGTCTCTACGAA
TACGAGGGCAACGTCGTCCCATATCTGGTTGTGGTCAAGGTCGGCAAGGAATCCGAACAAACGAGGCCCAAGCCT
GGCAACCGCGGAAAGCGAGATTCTCAGATCCTTCTAATGAGCTTCCTCAACCGCGTTCATCATCGTGCTCCTATG
AGCCCACTGGAGCTGGAAATGTTTCACCAAGTTAACAACATTATCGGTGTGGATCCCGAGCTCTATGAGTACCTG
CTTATGGTGGACGCCGATACCTCGGTTAGTGAAGATTCGCTGAATCGACTCGTCTCTGCATGTGCGCACAACGCG
AAGATTGCCGGGATATGTGGTGAGACGAGTCTGGAGAATGACGAAAAGTCGTGGACCACGATGATTCAGGTCTAC
GAGTATTTTATCTCGCATCACCTGGCAAAAGCCTTCGAGTCACTGTTCGGCAGCGTCACATGTTTGCCCGGATGC
TTTTCAATGTATCGGCTGCGAACGGCTGATAAAGGCAAACCGCTCATCATCTCGGATGCCGTAATTAAGGATTAC
AGCATCTGTGACGTCGACACTCTCCACCAGAAGAATTTGCTATCGCTTGGCGAGGATCGTTACCTGACGACGCTG
ATGACTAAATACTTTCCCTATATGGCATATAAGTTTGTTCCAGATGCTCAGTGCAAGACGGCTGCGCCCGAGTCT
TGGAGTGTTCTGGTGTCGCAACGGCGGCGCTGGATCAACTCCACCATCCACAATCTCGTCGAGCTAATGCGCCTT
GAGGAAATGTGTGGCTTCTGCTGCTTCAGCATGCGTTTTGTCGTTTTCATCGACCTCTTCGGCACGATCATTCTC
CCAGCCACGTGCGTTTATCTCGTATACCTCATCTACTTGGTTGCGTCGAAAACCGGCCAATTTCCACTCATCTCT
ATCGTTATGCTGGCAGCTGTGTACGGCCTGCAGGCGCTTGTCTTTATCCTCAAGCGGCAATGGCAGCATATCGGG
TGGATGATCATATACATCATAGCCTTCCCCATCTATTCCTTCATATTGCCCGTCTACTCCTTCTGGAACCAGGAC
AACTTCACGTGGGGAAACACCCGTGTTGTCATCGGCGAGAAGGGCAGCAAACAAGTCGTCGCCGTCGATGATGAA
GGCTTCGACCCTCGGTCCATCCCACTTCAGCGCTGGGACGACTATGCCCTTGCCAACAACCTGCCCGGGCGCCGT
GGAGGTTACCAGGAAAAGCACGACTTCGGGTACGGGTATGGCGACCAGTACGAAATGGATGAGATCAAGTCCATC
TATTCGGCAGCGCCCCAGGGCTCCGTCCTGACGGGCATGGGCGGTGGTCGCAATACTTTCATGCCCCCGCAGTCT
CCTGCTATTGGAGCCAACCGCGCCTCTACCATCACTCCTGGACTACATCACGATGCCGCCGCGTCTCTGCGCCGG
CAATCGATGATGTCGATGGGCAACGCCATGCATGACATACAGAGGAGCCAGTCGCCTTATCAAGACTTCCCCGCC
GGTCGACCCTGCATGATGAACACGCGCAGCATGTCCAATCTCTCTCCGGCCTTGGGCCTCCCCGCCAACCGCTCG
ACCTCGGCGCTCGGTTATACGGCTGGTCACCGTCCGCCGCTGGGCACTGATCCCATGCGATCCACGTCGTCGTTT
GACTTCCAGCGCGGCCACACCAGCGCAGACGACATGGCCATTGTGGAGGCCATCCAATCCGTTCTCCGTGAAGTC
GACCTCGACACAGTCACGAAGAAGCAGGTGCGCGCTCTCGTCGAGCAACGCTTGCAGACCGAATTGGTCGGCGAG
CGACGAACCTTCATGGATCGGCAAATCGATCGCGAATTGGAGAATATGTGA
Gene >Hirsu2|714
ATGGCGAACCGAATGTCCATCTTCTCGGCCTCCTCCGACTCACCCGGCAGCTCGCGAGCAGGCGGGCCTCAGACT
GCCCAGGTGTCGACCACCACCCTTCTGAACGCCGCCCACAACATCTATCTGTCTTCTCAGGCCCACCAGCTGGAT
GTCAGCACCTCGCTCGTCGTCAATACGTGGCTGACGGCCTCCCGAGGCGGCCCGACTGTCGACGCATCGCTGGCT
GCTAGGGCATGGGAGCATGCTCGTCGACGCGCTGAAGACGGCTGTGTCATCTTGGGGTTCGTTCTGGCCGCTGCC
GCCGTGCCATGGGCCTGAACTGACATCTTCCATCAGCTCACTTCACCAGTCGACACCGTCTGTCCTGGGCCCCTT
CCTTTCTAGCTTCCCGTTCGCTACACCCTCCAGCCTCCACAATGCTCTGGAGGCTGTCCAACCCTTCGTTCGATG
CATCACGCCTTACAACCCATCCATGCCGAGACAAGCTGCTCTCGGTGTCACCCTTACATTGAATCTGTCTGGAGA
CCTCACCGCTGCTTCGCTTGCCCTGTCCCAGGGCGGCATCGACACCGTCAATGGTTTGCTCAAGATTCCGCCAGA
GGCCGGCTATCGCGCCTTCGACGTCTTCTACTATCTCCTCACGTCTGCTTCAACCCCTGCCGAGCGAGAATTTCT
CGGGCTGCGGAGTCCCTCCACCTACGCACTCCTGGCTCGATCGGGCACTTACAACCCGCCCCCCTACCTGCCCAC
GGCGGATGATGCTGCCTCGGCCGATGATTTTCGACAGGCCCTCAAAAACATTGGAATCAAGGGCTCCGCTCACCG
CAACTTCATCTCGACTCTCGCCGGCCTGCTAAAGCTTGGCAATACACTCGATTATAGCATCGAGTCCGAGACGTT
GGCGGAAATATGCGATGATGTCAGTGGTCTTCTGGGTCTCGAGCCAGAGACTCTGCTCAGTCACTGTAGCACCCA
GGACCGCTGGACCTTTGTGGGCGGTCTCTACGAGTCTCTTGTCGATTGGGTTATATCCAAAGCCAACGAGGCCGT
GGCTACCCAAATGGAACGAATCAAGGCCGGCGACGAGTCACTCGATGGTCGTGCAGCGAGATCGTCAGTCTCCAA
CGAGGACAACGGAGACACGGTATCTATCACCGTCATTGAGATCCCCCGGACCACCCTTGGCAAGGCCTTGTGTAT
GCGTTCCATCTTCGACGACTTCCACGGCATCAACGCCGAGATGATCGAGGACGGCGTACAAGCCTCGCCTGCAGG
CTCATCTGTCTTGCGCGAGATGCAACAGGCCGTGTCCGAGGTCGCCCCTGATCTGGGTATCATGACGGGGCCGGA
AGGCAGGGAACGACAGTTCGAGCTCGAGAAAAGAGAGCAAGTGCTCGAGAAGATTGCCCTTGCCGCGGAAGATGG
CGGCTTCTTGAAAAAGCTACTCTTTCCTATCCTGGGCGAGGGCATCAATCTCGGTCATGCCGGGAGGCTTGACTT
GCCTGCCGTGCTGGCCTCAAACCGCCTGTGGTATCACCTCTGCCTTCATCCGACTGATGATTCTCCCGCACAGCT
CGCTGCTCTCCCGTCCGTCACCTCGGCTTGGTCGGCCGGCACAGTCTCCCGTCAACTGCGCTCCTGGAGGCTTCC
CGAGTGGGCAAATCGACGAAACAGGAACCTGGACTTCACAACTGATTTTGACGTGGATGAATTTGTTCAGCGCTA
CTCGGGCCTTGGATGCAGTGATGGGAGAGACGGCATCGAGAACTGGATGCTTGAGCGTGGATGGAGCAATGGCGA
GGTCTTCATTGGTAAAGAGCGCGTTTGGATGAGAGAGAGCGCTTGGTGGGAAGCGGAAAGCATGCTGGATCTCAA
GCCGGGAAACAGCAATGCCGGTGCTCAAGGCCCCCACGGAAATCCCTTCGGGTCCGCTTTTGATACAGGCTATTC
TATCGGTGGAACAGGTTATTTCCCCTCCCAGGCAATGGACGCGAACTTCAACGGCAGCAACGCAAGCAACGATCA
GCTACTCAATGCCCGCAACTTCAGTCAGGGCAACATTAGCCAAATGACTCTGAACCCCAATCCTCACCCGGCACC
TTCTATCGCGCACACCACGACGCGCCAGGTTAGCAATGGAGACTACGGCCTCGGTACAAAGGGAGACACGTACAA
AGGTGACGTGTACTATAACGAAGACGGTGAGTTCACGGGCACCATGGATCCGGAACTGGCCAAGAACAAGCACAT
ACAGACGAAGCCGGTGACGTTCGGTCGTCGGGTCTGGGTATGGATTGTGTGGGCCCTCACTTTTTGGATTCCCTC
ACCCTTACTCCGGTTCATTGGCCGGATGCGACGTCCGGACGTTCGTATGGCCTGGCGAGAGAAGCTTGTACTATG
TTTTGTCATCTTCCTCATCAACGCTATCATCATATTTTGGATCATCGGCTTCGGGCGACTTCTGTGCCCCAACTT
CGACAAAGCCTGGAGTGAACGGGAAGTTGGCCTCCACAAGGGCGAGGATGACTTTTGGGTCAGCATTCATGGCAA
GGTGTACGATATATCCAAGTTTTGGAGGCGCCAGCATAGCGATACGGACATCAAGACGACTAGCGACAACATGAT
GCCATTGGCCGGTCTCGACATGGACGGATACTTCCCAGTGCCTCTGAGCTCGGCATGCCAGGGTCTTGGGCTCAA
AGAGACTACGCGTCTGCTGGCTAACAACACACCTGAGTTTCCCAATGCGATCCACACTTCTGGCTTCTTCCAGCC
GAACCCTACCAGCGCTCTGCACAGGTCTGATTGGTACTGGACCAACTTTGAGCCCACCATCAAGCAGTACTACCA
CGGTGATCTTGTCCACAGCCAAAGCTTCGTCGAGTCCGCTGGCAAGGACACGCAGCGGATGTGGGCCAGGTACGA
CGACAAGATCTATGACTTAACCGACTACTTTCACACTCTGGACCTCGCCAATACCGATGCGAACAAGTTCCTGCA
TGTCAAGGTCAGCGATCTATGGAAGAACAATCCCGGTCAGAACATCAAGGACTCGCTTGATGGCGTAATTCGTGA
CTCGAATTCCGATTCCACTGAACATGCCAAGATCATGAACAGTTGGCTCTGCATTCAGAGGGCCTTCTACAAGGG
CATGACTGATTTTCGGGAAACGCCAAGGTGTACTGTCAACAACTGGATATTACTGGCCTTCACAATCATTGTTTG
TGCCGTCGTCCTCATCAAGTTCGTGTCGGCCCTCAGGTTCAGTTCCAAACGTCGTCCGTCGCCGCAGGATAAATT
TGTTATTTGCCAAGTCCCGGCATACACAGAAGGCGAGGACTCGTTGCGCAAGGCGCTAGATTCGCTGACCGCCTT
GCAATACGACAATAAAAGAAAGCTTATTTGCGTCATATGCGACGGCGTCATCGTCGGTCAGGGCAACGATAGGCC
TACTCCAAAGATCGTGCTGGACATTCTTGGGGTCGATCCAAAAGTCGACCCTCCTGCCCTCCCGTTCAAGTCTGT
GGGCCCCGGCAGCGAGCAGCTTAATTACGGCAAAGTCTATTCTGGTCTCTACGAATACGAGGGCAACGTCGTCCC
ATATCTGGTTGTGGTCAAGGTCGGCAAGGAATCCGAACAAACGAGGCCCAAGCCTGGCAACCGCGGAAAGCGAGA
TTCTCAGATCCTTCTAATGAGCTTCCTCAACCGCGTTCATCATCGTGCTCCTATGAGCCCACTGGAGCTGGAAAT
GTTTCACCAAGTTAACAACATTATCGGTGTGGATCCCGAGCTCTATGAGTACCTGCTTATGGTGGACGCCGATAC
CTCGGTTAGTGAAGATTCGCTGAATCGACTCGTCTCTGCATGTGCGCACAACGCGAAGATTGCCGGGATATGTGG
TGAGACGAGTCTGGAGAATGACGAAAAGTCGTGGACCACGATGATTCAGGTCTACGAGTATTTTATCTCGCATCA
CCTGGCAAAAGCCTTCGAGTCACTGTTCGGCAGCGTCACATGTTTGCCCGGATGGTATGTTTCCGCACAGCGGCG
AAACTCCTCGCTTTCTCTCCGCTCACCTCAGGCCTAACAAACTAACCCATGAGCGCAGCTTTTCAATGTATCGGC
TGCGAACGGCTGATAAAGGCAAACCGCTCATCATCTCGGATGCCGTAATTAAGGATTACAGCATCTGTGACGTCG
ACACTCTCCACCAGAAGAATTTGCTATCGCTTGGCGAGGATCGTTACCTGACGACGCTGATGACTAAATACTTTC
CCTATATGGCATATAAGTTTGTTCCAGATGCTCAGTGCAAGACGGCTGCGCCCGAGTCTTGGAGTGTTCTGGTGT
CGCAACGGCGGCGCTGGATCAACTCCACCATCCACAATCTCGTCGAGCTAATGCGCCTTGAGGAAATGTGTGGCT
TCTGCTGCTTCAGCATGCGTTTTGTCGTTTTCATCGACCTCTTCGGCACGATCATTCTCCCAGCCACGTGCGTTT
ATCTCGTATACCTCATCTACTTGGTTGCGTCGAAAACCGGCCAATTTCCACTCATCTCTATCGTTATGCTGGCAG
CTGTGTACGGCCTGCAGGCGCTTGTCTTTATCCTCAAGCGGCAATGGCAGCATATCGGGTGGATGATCATATACA
TCATAGCCTTCCCCATCTATTCCTTCATATTGCCCGTCTACTCCTTCTGGAACCAGGACAACTTCACGTGGGGAA
ACACCCGTGTTGTCATCGGCGAGAAGGGCAGCAAACAAGTCGTCGCCGTCGATGATGAAGGCTTCGACCCTCGGT
CCATCCCACTTCAGCGCTGGGACGACTATGCCCTTGCCAACAACCTGCCCGGGCGCCGTGGAGGTTACCAGGAAA
AGCACGACTTCGGGTACGGGTATGGCGACCAGTACGAAATGGATGAGATCAAGTCCATCTATTCGGCAGCGCCCC
AGGGCTCCGTCCTGACGGGCATGGGCGGTGGTCGCAATACTTTCATGCCCCCGCAGTCTCCTGCTATTGGAGCCA
ACCGCGCCTCTACCATCACTCCTGGACTACATCACGATGCCGCCGCGTCTCTGCGCCGGCAATCGATGATGTCGA
TGGGCAACGCCATGCATGACATACAGAGGAGCCAGTCGCCTTATCAAGACTTCCCCGCCGGTCGACCCTGCATGA
TGAACACGCGCAGCATGTCCAATCTCTCTCCGGCCTTGGGCCTCCCCGCCAACCGCTCGACCTCGGCGCTCGGTT
ATACGGCTGGTCACCGTCCGCCGCTGGGCACTGATCCCATGCGATCCACGTCGTCGTTTGACTTCCAGCGCGGCC
ACACCAGCGCAGACGACATGGCCATTGTGGAGGCCATCCAATCCGTTCTCCGTGAAGTCGACCTCGACACAGTCA
CGAAGAAGCAGGTGCGCGCTCTCGTCGAGCAACGCTTGCAGACCGAATTGGTCGGCGAGCGACGAACCTTCATGG
ATCGGCAAATCGATCGCGAATTGGAGAATATGTGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail