Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|7128
Gene name
LocationContig_4:42954..44139
Strand+
Gene length (bp)1185
Transcript length (bp)1008
Coding sequence length (bp)1008
Protein length (aa) 336

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04488 Gly_transf_sug Glycosyltransferase sugar-binding region containing DXD motif 2.2E-15 98 179

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P33300|SUR1_YEAST Mannosyl phosphorylinositol ceramide synthase SUR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SUR1 PE=1 SV=1 45 304 8.0E-51
sp|P38287|CSH1_YEAST Mannosyl phosphorylinositol ceramide synthase CSH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CSH1 PE=1 SV=1 12 304 4.0E-50
sp|Q9UT67|IMT2_SCHPO Inositol phosphoceramide mannosyltransferase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC4F11.04c PE=3 SV=1 31 325 1.0E-49
sp|Q10323|IMT3_SCHPO Inositol phosphoceramide mannosyltransferase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC17G8.11c PE=1 SV=1 72 328 1.0E-43
sp|O14084|IMT1_SCHPO Inositol phosphoceramide mannosyltransferase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=imt1 PE=3 SV=2 59 291 5.0E-28
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P33300|SUR1_YEAST Mannosyl phosphorylinositol ceramide synthase SUR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SUR1 PE=1 SV=1 45 304 8.0E-51
sp|P38287|CSH1_YEAST Mannosyl phosphorylinositol ceramide synthase CSH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CSH1 PE=1 SV=1 12 304 4.0E-50
sp|Q9UT67|IMT2_SCHPO Inositol phosphoceramide mannosyltransferase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC4F11.04c PE=3 SV=1 31 325 1.0E-49
sp|Q10323|IMT3_SCHPO Inositol phosphoceramide mannosyltransferase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC17G8.11c PE=1 SV=1 72 328 1.0E-43
sp|O14084|IMT1_SCHPO Inositol phosphoceramide mannosyltransferase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=imt1 PE=3 SV=2 59 291 5.0E-28
sp|Q5UQW4|YL373_MIMIV Uncharacterized glycosyltransferase L373 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L373 PE=3 SV=1 78 257 1.0E-16
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 35 0.5

Transmembrane Domains

Domain # Start End Length
1 12 34 22
2 299 318 19

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|7128
MASAHSRVRRLVVGLAGLGLLLLVASFLSHVIVAANRIFGRHAGIALTQEQIALAYRSTASSAPSSSSTSSSRRP
RPVPRIIHQIFHNWKDPGNETMPADWHDMRQSCIALHPTWEHKLWREDASRAFIQTEYPWFLDTYDNFRFPVQRV
DALRYFLLRHFGGIYMDLDNGCRANLEPLLYYPAWVTDGGQGALSNNILGAEPEHPFWILMTDSIKAWAGDFVLP
YITISYATGQWYETDMWQIYHASKPASDPDLLRVMMDMRPTGAPWVFFTAGRGGTWDNWDNQVLGWFGNHLFEAA
LYAFAALGLAFALAFALGRTLRRRRSRRGADELKL*
Coding >Hirsu2|7128
ATGGCCTCTGCACACTCCCGGGTTCGACGGCTCGTCGTTGGCCTGGCCGGCCTCGGCCTACTGCTGCTTGTCGCC
AGCTTCCTCTCGCACGTCATCGTCGCCGCCAACCGCATCTTCGGCCGCCATGCCGGCATTGCCCTGACCCAGGAG
CAAATCGCGCTCGCCTACCGCAGCACCGCCTCGTCCGCCCCCTCTTCCTCCTCCACTTCCTCGTCGCGACGACCC
AGGCCCGTGCCGCGCATCATCCACCAGATATTCCACAACTGGAAAGACCCAGGCAACGAGACGATGCCGGCCGAC
TGGCACGACATGCGCCAGTCCTGTATCGCCTTGCACCCCACCTGGGAGCACAAGCTCTGGCGTGAGGATGCCTCG
CGCGCCTTCATCCAGACCGAATATCCCTGGTTTCTCGACACGTACGATAACTTCCGCTTCCCCGTCCAGAGAGTC
GACGCCTTGCGATACTTTCTACTCAGGCACTTTGGCGGCATCTACATGGACCTTGACAATGGCTGTCGAGCCAAT
CTCGAGCCGCTCCTCTACTACCCGGCCTGGGTTACCGACGGCGGCCAGGGCGCCCTCAGCAATAACATTCTCGGC
GCCGAGCCCGAGCACCCCTTCTGGATCCTCATGACCGACTCCATCAAGGCCTGGGCCGGCGACTTCGTCCTGCCC
TACATCACCATCAGCTACGCCACCGGACAGTGGTACGAGACAGACATGTGGCAAATCTACCACGCCAGCAAGCCC
GCCAGCGACCCGGACCTGCTGCGCGTCATGATGGACATGCGCCCGACCGGCGCCCCCTGGGTCTTCTTCACCGCC
GGCCGCGGCGGCACCTGGGACAACTGGGACAACCAAGTCCTCGGCTGGTTCGGCAACCACCTGTTCGAGGCCGCC
CTGTACGCCTTCGCCGCCCTCGGCCTCGCCTTTGCCCTAGCCTTTGCCCTTGGCCGCACCCTGAGGCGCCGGCGG
AGCCGCAGGGGCGCAGACGAGCTGAAGCTGTAA
Transcript >Hirsu2|7128
ATGGCCTCTGCACACTCCCGGGTTCGACGGCTCGTCGTTGGCCTGGCCGGCCTCGGCCTACTGCTGCTTGTCGCC
AGCTTCCTCTCGCACGTCATCGTCGCCGCCAACCGCATCTTCGGCCGCCATGCCGGCATTGCCCTGACCCAGGAG
CAAATCGCGCTCGCCTACCGCAGCACCGCCTCGTCCGCCCCCTCTTCCTCCTCCACTTCCTCGTCGCGACGACCC
AGGCCCGTGCCGCGCATCATCCACCAGATATTCCACAACTGGAAAGACCCAGGCAACGAGACGATGCCGGCCGAC
TGGCACGACATGCGCCAGTCCTGTATCGCCTTGCACCCCACCTGGGAGCACAAGCTCTGGCGTGAGGATGCCTCG
CGCGCCTTCATCCAGACCGAATATCCCTGGTTTCTCGACACGTACGATAACTTCCGCTTCCCCGTCCAGAGAGTC
GACGCCTTGCGATACTTTCTACTCAGGCACTTTGGCGGCATCTACATGGACCTTGACAATGGCTGTCGAGCCAAT
CTCGAGCCGCTCCTCTACTACCCGGCCTGGGTTACCGACGGCGGCCAGGGCGCCCTCAGCAATAACATTCTCGGC
GCCGAGCCCGAGCACCCCTTCTGGATCCTCATGACCGACTCCATCAAGGCCTGGGCCGGCGACTTCGTCCTGCCC
TACATCACCATCAGCTACGCCACCGGACAGTGGTACGAGACAGACATGTGGCAAATCTACCACGCCAGCAAGCCC
GCCAGCGACCCGGACCTGCTGCGCGTCATGATGGACATGCGCCCGACCGGCGCCCCCTGGGTCTTCTTCACCGCC
GGCCGCGGCGGCACCTGGGACAACTGGGACAACCAAGTCCTCGGCTGGTTCGGCAACCACCTGTTCGAGGCCGCC
CTGTACGCCTTCGCCGCCCTCGGCCTCGCCTTTGCCCTAGCCTTTGCCCTTGGCCGCACCCTGAGGCGCCGGCGG
AGCCGCAGGGGCGCAGACGAGCTGAAGCTGTAA
Gene >Hirsu2|7128
ATGGCCTCTGCACACTCCCGGGTTCGACGGCTCGTCGTTGGCCTGGCCGGCCTCGGCCTACTGCTGCTTGTCGCC
AGCTTCCTCTCGCACGTCATCGTCGCCGCCAACCGCATCTTCGGCCGCCATGCCGGCATTGCCCTGACCCAGGAG
CAAATCGCGCTCGCCTACCGCAGCACCGCCTCGTCCGCCCCCTCTTCCTCCTCCACTTCCTCGTCGCGACGACCC
AGGCCCGTGCCGCGCATCATCCACCAGATATTCCACAACTGGAAAGACCCAGGCAACGAGACGATGCCGGCCGAC
TGGCACGACATGCGCCAGTCCTGTATCGCCTTGCACCCCACCTGGGAGCACAAGGTATCGCCCTTCTCTGCCTCT
GCAAGGTTACTTTTCCCTCGTCGCATGCAAGGACGGCAGCTAAGCCCAAGGCCGCCGCTGGCCCATGACTTGACA
GCTCTGGCGTGAGGATGCCTCGCGCGCCTTCATCCAGACCGAATATCCCTGGTTTCTCGACACGTACGATAACTT
CCGCTTCCCCGTCCAGAGAGTCGACGCCTTGCGATACTTTCTACTCAGGCACTTTGGCGGCATCTACATGGACCT
TGACAATGTAAGAGAGAGAGAGAGTGAGAGAGAGAAGAGCACTAGTGACAGGAGGGTACTTGCTAACCACCGCCT
CGCCCCCAATAGGGCTGTCGAGCCAATCTCGAGCCGCTCCTCTACTACCCGGCCTGGGTTACCGACGGCGGCCAG
GGCGCCCTCAGCAATAACATTCTCGGCGCCGAGCCCGAGCACCCCTTCTGGATCCTCATGACCGACTCCATCAAG
GCCTGGGCCGGCGACTTCGTCCTGCCCTACATCACCATCAGCTACGCCACCGGACAGTGGTACGAGACAGACATG
TGGCAAATCTACCACGCCAGCAAGCCCGCCAGCGACCCGGACCTGCTGCGCGTCATGATGGACATGCGCCCGACC
GGCGCCCCCTGGGTCTTCTTCACCGCCGGCCGCGGCGGCACCTGGGACAACTGGGACAACCAAGTCCTCGGCTGG
TTCGGCAACCACCTGTTCGAGGCCGCCCTGTACGCCTTCGCCGCCCTCGGCCTCGCCTTTGCCCTAGCCTTTGCC
CTTGGCCGCACCCTGAGGCGCCGGCGGAGCCGCAGGGGCGCAGACGAGCTGAAGCTGTAA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail