Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|7127
Gene name
LocationContig_4:38366..39470
Strand-
Gene length (bp)1104
Transcript length (bp)1104
Coding sequence length (bp)1104
Protein length (aa) 368

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04488 Gly_transf_sug Glycosyltransferase sugar-binding region containing DXD motif 3.0E-08 151 205

Swissprot hits

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Golgi apparatus Signal peptide|Transmembrane domain 0.1983 0.2016 0.1799 0.1588 0.1343 0.0401 0.5833 0.1978 0.7706 0.0451

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup201
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7636
Ophiocordyceps australis map64 (Brazil) OphauB2|2476
Ophiocordyceps australis map64 (Brazil) OphauB2|3326
Ophiocordyceps camponoti-floridani Ophcf2|01608
Ophiocordyceps camponoti-floridani Ophcf2|02341
Ophiocordyceps camponoti-rufipedis Ophun1|1578
Ophiocordyceps camponoti-rufipedis Ophun1|1921
Ophiocordyceps kimflemingae Ophio5|1705
Ophiocordyceps kimflemingae Ophio5|3099
Ophiocordyceps subramaniannii Hirsu2|10364
Ophiocordyceps subramaniannii Hirsu2|7127 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|7127
MVFSLSLYCFSPGLFRWGDYVRQTNPFSGQDRVEQDFTPTSRELACLYGLPPRPGQPPLLSSSHTSSSSESELTA
ANSIPNVAHFIFLQKLPLDHAGQGDFNFLSYLSVRSAIVSLKPTKVLLHYGYVGDEAHRSSEGDGADPLIRNNEW
IERLRHDVEFVRHDGPLNSSLQHSEHLADKLRLEILLEHGGIYLDIDAFALRPFTHVLESPHPHDVVMGNEGGNR
AGLCNAVMAARPNSTFVKRWLETYETADLNAEWNYHSVLLPKQLAGQHPDEICELPPDSFFWPTWTWRHVEWMHE
PLDQADTRRWQKRIQRTGGSLFDNQLAYHAWSQMARDRYLRRLTPEVVRNEDTRFNLLVRRFIAEDL*
Coding >Hirsu2|7127
ATGGTATTCAGCTTGAGTCTGTATTGCTTTTCTCCTGGCCTCTTTCGATGGGGTGACTACGTCCGACAGACGAAT
CCCTTCTCCGGCCAGGACCGCGTCGAGCAAGACTTCACCCCCACCTCACGAGAGCTTGCTTGCCTGTACGGCTTG
CCGCCTCGGCCAGGCCAGCCGCCGCTGCTCTCCTCTTCCCATACATCCTCGAGCTCCGAATCCGAGTTGACCGCC
GCGAATTCGATCCCCAATGTTGCGCACTTCATTTTCCTGCAGAAGCTTCCGCTCGACCACGCCGGCCAGGGAGAC
TTCAACTTCCTCAGCTACCTGTCCGTTCGGAGCGCCATCGTCTCGCTCAAGCCGACCAAGGTCCTCTTGCATTAC
GGCTACGTCGGCGACGAAGCGCACCGGAGCAGCGAAGGAGATGGCGCAGACCCCCTCATACGAAACAACGAATGG
ATCGAGCGGCTGAGGCATGACGTCGAGTTTGTCCGACACGACGGGCCCCTCAACAGCTCCCTGCAACACTCGGAG
CATCTAGCCGACAAGCTGCGCCTCGAGATTTTGCTCGAGCACGGCGGCATTTATCTAGACATCGACGCCTTTGCT
CTGCGACCCTTTACACACGTGCTCGAGTCGCCTCACCCGCACGATGTCGTTATGGGGAACGAGGGCGGGAACCGC
GCGGGCCTCTGCAACGCCGTCATGGCGGCAAGGCCCAACAGCACTTTTGTCAAACGCTGGCTCGAGACGTACGAG
ACAGCGGACCTCAACGCGGAGTGGAACTACCACAGCGTCTTACTGCCCAAGCAGCTCGCGGGCCAACATCCGGAC
GAGATATGTGAACTTCCGCCAGACTCCTTCTTCTGGCCGACCTGGACTTGGAGACACGTCGAGTGGATGCACGAG
CCCTTGGACCAGGCCGACACGCGGCGCTGGCAGAAGAGGATACAGCGGACCGGGGGCAGCCTCTTCGACAACCAG
CTGGCATACCACGCATGGAGCCAAATGGCACGGGATCGGTACCTGCGCCGCTTGACGCCAGAGGTGGTGCGAAAT
GAAGACACTAGGTTTAATCTTTTAGTCAGGCGCTTCATCGCGGAGGATTTGTGA
Transcript >Hirsu2|7127
ATGGTATTCAGCTTGAGTCTGTATTGCTTTTCTCCTGGCCTCTTTCGATGGGGTGACTACGTCCGACAGACGAAT
CCCTTCTCCGGCCAGGACCGCGTCGAGCAAGACTTCACCCCCACCTCACGAGAGCTTGCTTGCCTGTACGGCTTG
CCGCCTCGGCCAGGCCAGCCGCCGCTGCTCTCCTCTTCCCATACATCCTCGAGCTCCGAATCCGAGTTGACCGCC
GCGAATTCGATCCCCAATGTTGCGCACTTCATTTTCCTGCAGAAGCTTCCGCTCGACCACGCCGGCCAGGGAGAC
TTCAACTTCCTCAGCTACCTGTCCGTTCGGAGCGCCATCGTCTCGCTCAAGCCGACCAAGGTCCTCTTGCATTAC
GGCTACGTCGGCGACGAAGCGCACCGGAGCAGCGAAGGAGATGGCGCAGACCCCCTCATACGAAACAACGAATGG
ATCGAGCGGCTGAGGCATGACGTCGAGTTTGTCCGACACGACGGGCCCCTCAACAGCTCCCTGCAACACTCGGAG
CATCTAGCCGACAAGCTGCGCCTCGAGATTTTGCTCGAGCACGGCGGCATTTATCTAGACATCGACGCCTTTGCT
CTGCGACCCTTTACACACGTGCTCGAGTCGCCTCACCCGCACGATGTCGTTATGGGGAACGAGGGCGGGAACCGC
GCGGGCCTCTGCAACGCCGTCATGGCGGCAAGGCCCAACAGCACTTTTGTCAAACGCTGGCTCGAGACGTACGAG
ACAGCGGACCTCAACGCGGAGTGGAACTACCACAGCGTCTTACTGCCCAAGCAGCTCGCGGGCCAACATCCGGAC
GAGATATGTGAACTTCCGCCAGACTCCTTCTTCTGGCCGACCTGGACTTGGAGACACGTCGAGTGGATGCACGAG
CCCTTGGACCAGGCCGACACGCGGCGCTGGCAGAAGAGGATACAGCGGACCGGGGGCAGCCTCTTCGACAACCAG
CTGGCATACCACGCATGGAGCCAAATGGCACGGGATCGGTACCTGCGCCGCTTGACGCCAGAGGTGGTGCGAAAT
GAAGACACTAGGTTTAATCTTTTAGTCAGGCGCTTCATCGCGGAGGATTTGTGA
Gene >Hirsu2|7127
ATGGTATTCAGCTTGAGTCTGTATTGCTTTTCTCCTGGCCTCTTTCGATGGGGTGACTACGTCCGACAGACGAAT
CCCTTCTCCGGCCAGGACCGCGTCGAGCAAGACTTCACCCCCACCTCACGAGAGCTTGCTTGCCTGTACGGCTTG
CCGCCTCGGCCAGGCCAGCCGCCGCTGCTCTCCTCTTCCCATACATCCTCGAGCTCCGAATCCGAGTTGACCGCC
GCGAATTCGATCCCCAATGTTGCGCACTTCATTTTCCTGCAGAAGCTTCCGCTCGACCACGCCGGCCAGGGAGAC
TTCAACTTCCTCAGCTACCTGTCCGTTCGGAGCGCCATCGTCTCGCTCAAGCCGACCAAGGTCCTCTTGCATTAC
GGCTACGTCGGCGACGAAGCGCACCGGAGCAGCGAAGGAGATGGCGCAGACCCCCTCATACGAAACAACGAATGG
ATCGAGCGGCTGAGGCATGACGTCGAGTTTGTCCGACACGACGGGCCCCTCAACAGCTCCCTGCAACACTCGGAG
CATCTAGCCGACAAGCTGCGCCTCGAGATTTTGCTCGAGCACGGCGGCATTTATCTAGACATCGACGCCTTTGCT
CTGCGACCCTTTACACACGTGCTCGAGTCGCCTCACCCGCACGATGTCGTTATGGGGAACGAGGGCGGGAACCGC
GCGGGCCTCTGCAACGCCGTCATGGCGGCAAGGCCCAACAGCACTTTTGTCAAACGCTGGCTCGAGACGTACGAG
ACAGCGGACCTCAACGCGGAGTGGAACTACCACAGCGTCTTACTGCCCAAGCAGCTCGCGGGCCAACATCCGGAC
GAGATATGTGAACTTCCGCCAGACTCCTTCTTCTGGCCGACCTGGACTTGGAGACACGTCGAGTGGATGCACGAG
CCCTTGGACCAGGCCGACACGCGGCGCTGGCAGAAGAGGATACAGCGGACCGGGGGCAGCCTCTTCGACAACCAG
CTGGCATACCACGCATGGAGCCAAATGGCACGGGATCGGTACCTGCGCCGCTTGACGCCAGAGGTGGTGCGAAAT
GAAGACACTAGGTTTAATCTTTTAGTCAGGCGCTTCATCGCGGAGGATTTGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail