Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|7125
Gene name
LocationContig_4:33926..34868
Strand+
Gene length (bp)942
Transcript length (bp)801
Coding sequence length (bp)801
Protein length (aa) 267

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03194 LUC7 LUC7 N_terminus 1.8E-67 4 236

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9USM4|LUC7_SCHPO U1 snRNP-associated protein usp106 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=usp106 PE=1 SV=1 1 250 1.0E-64
sp|Q07508|LUC7_YEAST Protein LUC7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LUC7 PE=1 SV=1 2 231 1.0E-54
sp|Q9Y383|LC7L2_HUMAN Putative RNA-binding protein Luc7-like 2 OS=Homo sapiens GN=LUC7L2 PE=1 SV=2 3 227 7.0E-39
sp|Q7TNC4|LC7L2_MOUSE Putative RNA-binding protein Luc7-like 2 OS=Mus musculus GN=Luc7l2 PE=1 SV=1 3 227 2.0E-38
sp|Q9CYI4|LUC7L_MOUSE Putative RNA-binding protein Luc7-like 1 OS=Mus musculus GN=Luc7l PE=1 SV=2 3 227 1.0E-37
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9USM4|LUC7_SCHPO U1 snRNP-associated protein usp106 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=usp106 PE=1 SV=1 1 250 1.0E-64
sp|Q07508|LUC7_YEAST Protein LUC7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LUC7 PE=1 SV=1 2 231 1.0E-54
sp|Q9Y383|LC7L2_HUMAN Putative RNA-binding protein Luc7-like 2 OS=Homo sapiens GN=LUC7L2 PE=1 SV=2 3 227 7.0E-39
sp|Q7TNC4|LC7L2_MOUSE Putative RNA-binding protein Luc7-like 2 OS=Mus musculus GN=Luc7l2 PE=1 SV=1 3 227 2.0E-38
sp|Q9CYI4|LUC7L_MOUSE Putative RNA-binding protein Luc7-like 1 OS=Mus musculus GN=Luc7l PE=1 SV=2 3 227 1.0E-37
sp|Q9NQ29|LUC7L_HUMAN Putative RNA-binding protein Luc7-like 1 OS=Homo sapiens GN=LUC7L PE=1 SV=1 3 227 2.0E-37
sp|Q3SX41|LC7L3_BOVIN Luc7-like protein 3 OS=Bos taurus GN=LUC7L3 PE=2 SV=1 7 235 1.0E-26
sp|Q5SUF2|LC7L3_MOUSE Luc7-like protein 3 OS=Mus musculus GN=Luc7l3 PE=1 SV=1 7 235 1.0E-26
sp|Q5R8W6|LC7L3_PONAB Luc7-like protein 3 OS=Pongo abelii GN=LUC7L3 PE=2 SV=1 7 235 1.0E-26
sp|O95232|LC7L3_HUMAN Luc7-like protein 3 OS=Homo sapiens GN=LUC7L3 PE=1 SV=2 7 235 1.0E-26
sp|Q09217|YP68_CAEEL Uncharacterized protein B0495.8 OS=Caenorhabditis elegans GN=B0495.8 PE=3 SV=1 1 236 1.0E-22
sp|Q54XQ8|LUC7L_DICDI Luc7-like protein OS=Dictyostelium discoideum GN=crop PE=3 SV=1 25 227 7.0E-18
[Show less]

GO

GO Term Description Terminal node
GO:0005685 U1 snRNP Yes
GO:0006376 mRNA splice site selection Yes
GO:0003729 mRNA binding Yes
GO:0005488 binding No
GO:0097159 organic cyclic compound binding No
GO:0003676 nucleic acid binding No
GO:0120114 Sm-like protein family complex No
GO:0071826 ribonucleoprotein complex subunit organization No
GO:0044428 nuclear part No
GO:0034622 cellular protein-containing complex assembly No
GO:0065003 protein-containing complex assembly No
GO:1990904 ribonucleoprotein complex No
GO:0008150 biological_process No
GO:0022618 ribonucleoprotein complex assembly No
GO:0003674 molecular_function No
GO:0044422 organelle part No
GO:0005575 cellular_component No
GO:0044446 intracellular organelle part No
GO:0022607 cellular component assembly No
GO:0097525 spliceosomal snRNP complex No
GO:0044464 cell part No
GO:0071840 cellular component organization or biogenesis No
GO:0016043 cellular component organization No
GO:0030532 small nuclear ribonucleoprotein complex No
GO:0044424 intracellular part No
GO:0043933 protein-containing complex subunit organization No
GO:0032991 protein-containing complex No
GO:0003723 RNA binding No
GO:1901363 heterocyclic compound binding No
GO:0009987 cellular process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 25 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|7125
MAAEQRKLLEQLMGSSSTSRDALSLDDPKVCRSYIVGTCPHDLFTNTKQDFGPCGRVHSEGLKAEYEALPERERQ
RHGFEYDYLRDLHKYIDDCNRRIDSAQKRLEKTPEEIRQTNDLLESIADLEENIKCGLQEIQLYTEKDLVSIAIE
EWFNLKVMAQTKADKEKELKALSDTSGPSGHQKLQVCDVCGAYLSRLDNDRRLADHFYGKMHLGYAQMRKAYDSF
PKEMKSRARQQPPMEDDGQRGPKGSGGYRSYKGGARGHRGG*
Coding >Hirsu2|7125
ATGGCAGCAGAGCAGAGGAAGCTGCTGGAGCAGCTCATGGGCAGCTCGTCGACGTCGCGTGACGCCCTCTCGCTC
GACGACCCCAAAGTTTGCCGCTCGTACATTGTGGGCACCTGCCCTCACGACCTCTTCACCAATACCAAGCAGGAT
TTTGGCCCCTGCGGCCGCGTGCACTCTGAGGGCCTCAAGGCCGAATACGAGGCTTTGCCGGAGCGCGAGAGACAG
AGGCACGGTTTTGAGTACGACTACCTCCGCGACCTCCACAAGTATATCGATGACTGCAACCGCCGCATCGACTCC
GCCCAGAAGCGTCTGGAGAAGACACCCGAGGAGATTCGTCAGACCAATGACTTGCTCGAGAGTATCGCCGACCTC
GAAGAGAACATCAAATGCGGCCTCCAGGAAATCCAGTTGTATACCGAGAAGGACCTCGTGTCCATCGCCATCGAG
GAATGGTTCAATCTCAAGGTCATGGCGCAGACCAAGGCCGACAAGGAAAAGGAGCTGAAGGCGCTTTCGGACACG
TCGGGTCCGTCCGGTCACCAGAAGCTCCAGGTCTGCGACGTCTGCGGCGCCTATCTCAGCCGGCTCGACAACGAC
CGCCGCCTGGCGGACCATTTCTACGGCAAGATGCACCTGGGCTACGCGCAGATGCGCAAGGCCTACGACTCCTTC
CCCAAGGAGATGAAGAGCCGCGCCCGCCAGCAACCCCCCATGGAGGACGACGGGCAGCGTGGACCTAAAGGGTCA
GGCGGCTACAGAAGCTACAAGGGGGGCGCCAGAGGCCACCGTGGTGGCTAG
Transcript >Hirsu2|7125
ATGGCAGCAGAGCAGAGGAAGCTGCTGGAGCAGCTCATGGGCAGCTCGTCGACGTCGCGTGACGCCCTCTCGCTC
GACGACCCCAAAGTTTGCCGCTCGTACATTGTGGGCACCTGCCCTCACGACCTCTTCACCAATACCAAGCAGGAT
TTTGGCCCCTGCGGCCGCGTGCACTCTGAGGGCCTCAAGGCCGAATACGAGGCTTTGCCGGAGCGCGAGAGACAG
AGGCACGGTTTTGAGTACGACTACCTCCGCGACCTCCACAAGTATATCGATGACTGCAACCGCCGCATCGACTCC
GCCCAGAAGCGTCTGGAGAAGACACCCGAGGAGATTCGTCAGACCAATGACTTGCTCGAGAGTATCGCCGACCTC
GAAGAGAACATCAAATGCGGCCTCCAGGAAATCCAGTTGTATACCGAGAAGGACCTCGTGTCCATCGCCATCGAG
GAATGGTTCAATCTCAAGGTCATGGCGCAGACCAAGGCCGACAAGGAAAAGGAGCTGAAGGCGCTTTCGGACACG
TCGGGTCCGTCCGGTCACCAGAAGCTCCAGGTCTGCGACGTCTGCGGCGCCTATCTCAGCCGGCTCGACAACGAC
CGCCGCCTGGCGGACCATTTCTACGGCAAGATGCACCTGGGCTACGCGCAGATGCGCAAGGCCTACGACTCCTTC
CCCAAGGAGATGAAGAGCCGCGCCCGCCAGCAACCCCCCATGGAGGACGACGGGCAGCGTGGACCTAAAGGGTCA
GGCGGCTACAGAAGCTACAAGGGGGGCGCCAGAGGCCACCGTGGTGGCTAG
Gene >Hirsu2|7125
ATGGCAGCAGAGCAGAGGAAGCTGCTGGAGCAGCTCATGGGCAGCTCGTCGACGTCGCGTGACGCCCTCTCGCTC
GACGACCCCAAAGTTTGCCGCTCGTACATTGTGGGCACCTGCCCTCACGACCTCTTCACCAATACCAAGCAGGAT
TTTGGCCCCTGCGGCCGCGTGCACTCTGAGGGCCTCAAGGCCGAATACGAGGCTTTGCCGGAGCGCGAGAGACAG
AGGCACGGTTTTGAGTACGACTACCTCCGCGACCTCCACAAGTATATCGATGACTGCAACCGCCGCATCGACTCC
GCCCAGAAGCGTCTGGAGAAGACACCCGAGGAGATTCGTCAGACCAATGACTTGGTGGGTTCCCTGCCCAACTCC
CCCTTCCGGGGCCTCTTCTTGCTTCACCTGCGGGGGCGTGTCTTACTCGCAAGCCGATGCCCGCTGCCGCTCCCT
CGTCTTGTACAGGCAAACTGACCACCTTCCCCTCTCCTCATCCAGCTCGAGAGTATCGCCGACCTCGAAGAGAAC
ATCAAATGCGGCCTCCAGGAAATCCAGTTGTATACCGAGAAGGACCTCGTGTCCATCGCCATCGAGGAATGGTTC
AATCTCAAGGTCATGGCGCAGACCAAGGCCGACAAGGAAAAGGAGCTGAAGGCGCTTTCGGACACGTCGGGTCCG
TCCGGTCACCAGAAGCTCCAGGTCTGCGACGTCTGCGGCGCCTATCTCAGCCGGCTCGACAACGACCGCCGCCTG
GCGGACCATTTCTACGGCAAGATGCACCTGGGCTACGCGCAGATGCGCAAGGCCTACGACTCCTTCCCCAAGGAG
ATGAAGAGCCGCGCCCGCCAGCAACCCCCCATGGAGGACGACGGGCAGCGTGGACCTAAAGGGTCAGGCGGCTAC
AGAAGCTACAAGGGGGGCGCCAGAGGCCACCGTGGTGGCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail