Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|7124
Gene name
LocationContig_4:31508..33393
Strand-
Gene length (bp)1885
Transcript length (bp)1767
Coding sequence length (bp)1767
Protein length (aa) 589

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04113 Gpi16 Gpi16 subunit, GPI transamidase component 2.9E-245 8 578

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P38875|GPI16_YEAST GPI transamidase component GPI16 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GPI16 PE=1 SV=2 22 570 2.0E-120
sp|O94380|GPI16_SCHPO GPI transamidase component PIG-T homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gpi16 PE=3 SV=1 60 558 6.0E-94
sp|Q969N2|PIGT_HUMAN GPI transamidase component PIG-T OS=Homo sapiens GN=PIGT PE=1 SV=1 24 581 1.0E-83
sp|Q8BXQ2|PIGT_MOUSE GPI transamidase component PIG-T OS=Mus musculus GN=Pigt PE=1 SV=2 24 581 2.0E-83

GO

GO Term Description Terminal node
GO:0042765 GPI-anchor transamidase complex Yes
GO:0016255 attachment of GPI anchor to protein Yes
GO:0044425 membrane part No
GO:0043412 macromolecule modification No
GO:0044237 cellular metabolic process No
GO:0043170 macromolecule metabolic process No
GO:1902494 catalytic complex No
GO:0071704 organic substance metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0044238 primary metabolic process No
GO:0044267 cellular protein metabolic process No
GO:0008152 metabolic process No
GO:0008150 biological_process No
GO:0044260 cellular macromolecule metabolic process No
GO:0036211 protein modification process No
GO:0044422 organelle part No
GO:0098796 membrane protein complex No
GO:0005575 cellular_component No
GO:0044446 intracellular organelle part No
GO:0006464 cellular protein modification process No
GO:0009987 cellular process No
GO:1901564 organonitrogen compound metabolic process No
GO:0032991 protein-containing complex No
GO:0044424 intracellular part No
GO:0044432 endoplasmic reticulum part No
GO:0019538 protein metabolic process No
GO:0044444 cytoplasmic part No
GO:0044464 cell part No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 20 0.45

Transmembrane Domains

Domain # Start End Length
1 532 554 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|7124
MRQLLTVLLLSLVPSFVAAAEYHEQLTLRPLPLSALLASFNFRSNTSIADFEAHNFRLFPRSLGQILQYAGTQEL
HLRFTLGRWDAERWGARPWGGTREGGTGVELWAWLDARTEEEADENWLTLTNALSGLFCASLNFIDGTRTIRPVM
SFQPEGHHSDDALASTRLLHGVLPHEVVCTENLTPFLKLLPCKGKAGIASLLDGHKLFDASFQSMAIDVRPVCVP
GNPCVLQMEQTIDMVLDVHRSKRPRDNPIPRPPPSQDLVCDTSKPYHDSATCFPADHLHGQDWVLSDIFGRTMKG
VCPLTDRETAPICLQVPDSRGVFAAGGDRARDVKEQGGSTRCYRPESDSSEFNLVLAKPEGDVAAVAMDIVEPET
PLLYAERSFMGHGQEHGGVQAILTNPSETEVEFVYMESLPWFMRIYLHTLSTRISSSSSATNASSKIVEEIYYRP
ALDRARGTQLELLMRIPPRCTVFLTYDFEKSILRYTEYPPDANRGFDVAAAVISTRAPRAGLNVRTTSLLLYLPT
PDFSMPYNVIIFTSTAIALTFGGLYNILVRRLVGADEAPSAMLKTKVARLLSTFRGRRKAAQS*
Coding >Hirsu2|7124
ATGCGCCAACTACTGACCGTTCTCCTCCTCTCGCTCGTCCCCAGTTTCGTCGCAGCCGCCGAATACCACGAGCAA
CTCACTCTCCGACCTCTACCGCTCTCTGCCCTGCTCGCGAGTTTCAACTTCCGATCCAATACGTCCATCGCCGAC
TTTGAGGCGCACAACTTCCGCCTCTTTCCGCGGTCCCTGGGCCAGATCCTGCAGTATGCCGGGACGCAAGAGCTG
CATCTCAGATTTACCCTCGGCCGCTGGGACGCAGAGAGATGGGGTGCGAGGCCGTGGGGAGGCACGCGAGAAGGC
GGCACGGGCGTAGAGCTGTGGGCCTGGCTGGATGCCCGGACAGAAGAGGAGGCAGACGAGAATTGGCTGACGCTG
ACCAACGCCCTCTCCGGACTCTTCTGCGCCTCTCTCAACTTCATAGACGGCACGCGTACCATCCGACCCGTCATG
TCGTTCCAACCCGAGGGCCATCATTCGGACGATGCCCTGGCTAGCACCAGGCTTCTTCACGGAGTCTTGCCGCAC
GAGGTGGTTTGCACGGAGAACTTGACGCCCTTTCTGAAGCTCCTGCCTTGCAAGGGCAAAGCAGGCATCGCCAGT
CTGCTCGACGGGCACAAGCTATTTGACGCATCCTTCCAAAGCATGGCCATCGACGTGAGACCCGTCTGCGTTCCC
GGCAACCCCTGTGTCTTGCAGATGGAACAGACGATCGATATGGTGTTGGACGTGCACCGATCTAAGCGACCTCGG
GATAACCCCATTCCGCGTCCACCGCCCAGCCAGGATCTAGTCTGCGACACGTCCAAGCCATATCACGACAGCGCA
ACTTGTTTCCCTGCCGACCACCTGCATGGTCAGGACTGGGTTCTATCGGACATCTTTGGGCGCACGATGAAAGGC
GTTTGTCCCTTGACCGATAGGGAGACCGCACCCATCTGCCTGCAAGTCCCCGATTCACGCGGCGTCTTCGCCGCA
GGGGGCGATCGCGCCCGTGATGTCAAAGAGCAGGGCGGTTCAACGCGCTGCTACAGGCCCGAGTCGGACAGCAGC
GAATTCAACCTCGTGTTGGCCAAACCGGAGGGGGATGTGGCTGCTGTAGCCATGGATATTGTCGAGCCGGAGACG
CCACTTCTGTACGCCGAGCGCAGCTTCATGGGCCACGGCCAAGAGCACGGCGGCGTCCAGGCCATTCTCACTAAT
CCCAGCGAGACCGAAGTCGAGTTTGTCTACATGGAATCACTCCCCTGGTTCATGCGCATCTACCTTCACACGCTC
TCGACGCGCATCTCCTCGTCATCGTCGGCGACAAACGCCTCGTCGAAGATCGTCGAGGAAATCTACTATCGGCCG
GCCCTGGACCGCGCCCGTGGCACCCAGCTTGAGCTTCTGATGCGCATCCCGCCGCGTTGCACCGTCTTCCTCACC
TACGACTTCGAGAAGTCCATCTTACGCTACACTGAGTACCCGCCGGACGCCAACCGCGGCTTTGATGTGGCGGCG
GCCGTCATTTCCACCCGTGCCCCGCGCGCCGGTCTGAACGTGCGCACAACGAGCTTACTGCTGTACCTGCCGACA
CCAGACTTCAGCATGCCGTACAATGTCATCATCTTCACATCGACTGCCATTGCGCTAACGTTTGGCGGTCTGTAT
AATATCCTTGTCAGACGCCTGGTGGGCGCGGATGAGGCTCCGAGCGCCATGCTCAAGACCAAGGTGGCGAGGCTA
TTGAGCACATTCAGGGGCAGACGCAAGGCGGCACAATCATAG
Transcript >Hirsu2|7124
ATGCGCCAACTACTGACCGTTCTCCTCCTCTCGCTCGTCCCCAGTTTCGTCGCAGCCGCCGAATACCACGAGCAA
CTCACTCTCCGACCTCTACCGCTCTCTGCCCTGCTCGCGAGTTTCAACTTCCGATCCAATACGTCCATCGCCGAC
TTTGAGGCGCACAACTTCCGCCTCTTTCCGCGGTCCCTGGGCCAGATCCTGCAGTATGCCGGGACGCAAGAGCTG
CATCTCAGATTTACCCTCGGCCGCTGGGACGCAGAGAGATGGGGTGCGAGGCCGTGGGGAGGCACGCGAGAAGGC
GGCACGGGCGTAGAGCTGTGGGCCTGGCTGGATGCCCGGACAGAAGAGGAGGCAGACGAGAATTGGCTGACGCTG
ACCAACGCCCTCTCCGGACTCTTCTGCGCCTCTCTCAACTTCATAGACGGCACGCGTACCATCCGACCCGTCATG
TCGTTCCAACCCGAGGGCCATCATTCGGACGATGCCCTGGCTAGCACCAGGCTTCTTCACGGAGTCTTGCCGCAC
GAGGTGGTTTGCACGGAGAACTTGACGCCCTTTCTGAAGCTCCTGCCTTGCAAGGGCAAAGCAGGCATCGCCAGT
CTGCTCGACGGGCACAAGCTATTTGACGCATCCTTCCAAAGCATGGCCATCGACGTGAGACCCGTCTGCGTTCCC
GGCAACCCCTGTGTCTTGCAGATGGAACAGACGATCGATATGGTGTTGGACGTGCACCGATCTAAGCGACCTCGG
GATAACCCCATTCCGCGTCCACCGCCCAGCCAGGATCTAGTCTGCGACACGTCCAAGCCATATCACGACAGCGCA
ACTTGTTTCCCTGCCGACCACCTGCATGGTCAGGACTGGGTTCTATCGGACATCTTTGGGCGCACGATGAAAGGC
GTTTGTCCCTTGACCGATAGGGAGACCGCACCCATCTGCCTGCAAGTCCCCGATTCACGCGGCGTCTTCGCCGCA
GGGGGCGATCGCGCCCGTGATGTCAAAGAGCAGGGCGGTTCAACGCGCTGCTACAGGCCCGAGTCGGACAGCAGC
GAATTCAACCTCGTGTTGGCCAAACCGGAGGGGGATGTGGCTGCTGTAGCCATGGATATTGTCGAGCCGGAGACG
CCACTTCTGTACGCCGAGCGCAGCTTCATGGGCCACGGCCAAGAGCACGGCGGCGTCCAGGCCATTCTCACTAAT
CCCAGCGAGACCGAAGTCGAGTTTGTCTACATGGAATCACTCCCCTGGTTCATGCGCATCTACCTTCACACGCTC
TCGACGCGCATCTCCTCGTCATCGTCGGCGACAAACGCCTCGTCGAAGATCGTCGAGGAAATCTACTATCGGCCG
GCCCTGGACCGCGCCCGTGGCACCCAGCTTGAGCTTCTGATGCGCATCCCGCCGCGTTGCACCGTCTTCCTCACC
TACGACTTCGAGAAGTCCATCTTACGCTACACTGAGTACCCGCCGGACGCCAACCGCGGCTTTGATGTGGCGGCG
GCCGTCATTTCCACCCGTGCCCCGCGCGCCGGTCTGAACGTGCGCACAACGAGCTTACTGCTGTACCTGCCGACA
CCAGACTTCAGCATGCCGTACAATGTCATCATCTTCACATCGACTGCCATTGCGCTAACGTTTGGCGGTCTGTAT
AATATCCTTGTCAGACGCCTGGTGGGCGCGGATGAGGCTCCGAGCGCCATGCTCAAGACCAAGGTGGCGAGGCTA
TTGAGCACATTCAGGGGCAGACGCAAGGCGGCACAATCATAG
Gene >Hirsu2|7124
ATGCGCCAACTACTGACCGTTCTCCTCCTCTCGCTCGTCCCCAGTTTCGTCGCAGCCGCCGAATACCACGAGCAA
CTCACTCTCCGACCTCTACCGCTCTCTGCCCTGCTCGCGAGTTTCAACTTCCGATCCAATACGTCCATCGCCGAC
TTTGAGGCGCACAACTTCCGCCTCTTTCCGCGGTCCCTGGGCCAGATCCTGCAGTATGCCGGGACGCAAGAGCTG
CATCTCAGATTTACCCTCGGCCGCTGGGACGCAGAGAGATGGGGTGCGAGGCCGTGGGGAGGCACGCGAGAAGGC
GGCACGGGCGTAGAGCTGTGGGCCTGGCTGGATGCCCGGACAGAAGAGGAGGCAGACGAGAATTGGCTGACGCTG
ACCAACGCCCTCTCCGGACTCTTCTGCGCCTCTCTCAACTTCATAGACGGCACGCGTACCATCCGACCCGTCATG
TCGTTCCAACCCGAGGGCCATCATTCGGACGATGCCCTGGCTAGCACCAGGCTTCTTCACGGAGTCTTGCCGCAC
GAGGTGGTTTGCACGGAGAACTTGACGCCCTTTCTGAAGCTCCTGCCTTGCAAGGGCAAAGCAGGCATCGCCAGT
CTGCTCGACGGGCACAAGCTATTTGACGCATCCTTCCAAAGCATGGCCATCGACGTGAGACCCGTCTGCGTTCCC
GGCAACCCCTGTGTCTTGCAGATGGAACAGACGATCGATATGGTGTTGGACGTGCACCGATCTAAGCGACCTCGG
GGTATGTTGCTTCTTCTCTGTGTAAAACCTATAATGCGGATGCCTTGCGGCTGCAAAAGATAAGAACGAGGCTCT
GGAGCGACAGGATGAAGTCGGTACTGACCCAGTCGTGATTCCAGATAACCCCATTCCGCGTCCACCGCCCAGCCA
GGATCTAGTCTGCGACACGTCCAAGCCATATCACGACAGCGCAACTTGTTTCCCTGCCGACCACCTGCATGGTCA
GGACTGGGTTCTATCGGACATCTTTGGGCGCACGATGAAAGGCGTTTGTCCCTTGACCGATAGGGAGACCGCACC
CATCTGCCTGCAAGTCCCCGATTCACGCGGCGTCTTCGCCGCAGGGGGCGATCGCGCCCGTGATGTCAAAGAGCA
GGGCGGTTCAACGCGCTGCTACAGGCCCGAGTCGGACAGCAGCGAATTCAACCTCGTGTTGGCCAAACCGGAGGG
GGATGTGGCTGCTGTAGCCATGGATATTGTCGAGCCGGAGACGCCACTTCTGTACGCCGAGCGCAGCTTCATGGG
CCACGGCCAAGAGCACGGCGGCGTCCAGGCCATTCTCACTAATCCCAGCGAGACCGAAGTCGAGTTTGTCTACAT
GGAATCACTCCCCTGGTTCATGCGCATCTACCTTCACACGCTCTCGACGCGCATCTCCTCGTCATCGTCGGCGAC
AAACGCCTCGTCGAAGATCGTCGAGGAAATCTACTATCGGCCGGCCCTGGACCGCGCCCGTGGCACCCAGCTTGA
GCTTCTGATGCGCATCCCGCCGCGTTGCACCGTCTTCCTCACCTACGACTTCGAGAAGTCCATCTTACGCTACAC
TGAGTACCCGCCGGACGCCAACCGCGGCTTTGATGTGGCGGCGGCCGTCATTTCCACCCGTGCCCCGCGCGCCGG
TCTGAACGTGCGCACAACGAGCTTACTGCTGTACCTGCCGACACCAGACTTCAGCATGCCGTACAATGTCATCAT
CTTCACATCGACTGCCATTGCGCTAACGTTTGGCGGTCTGTATAATATCCTTGTCAGACGCCTGGTGGGCGCGGA
TGAGGCTCCGAGCGCCATGCTCAAGACCAAGGTGGCGAGGCTATTGAGCACATTCAGGGGCAGACGCAAGGCGGC
ACAATCATAG

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail