Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|7122
Gene name
LocationContig_4:23703..24950
Strand-
Gene length (bp)1247
Transcript length (bp)1158
Coding sequence length (bp)1158
Protein length (aa) 386

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00399 PIR Yeast PIR protein repeat 2.7E-06 234 249

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|B5VL27|CIS3_YEAS6 Cell wall mannoprotein CIS3 OS=Saccharomyces cerevisiae (strain AWRI1631) GN=CIS3 PE=3 SV=1 62 161 4.0E-31
sp|A6ZQH4|CIS3_YEAS7 Cell wall mannoprotein CIS3 OS=Saccharomyces cerevisiae (strain YJM789) GN=CIS3 PE=3 SV=1 62 161 4.0E-31
sp|P47001|CIS3_YEAST Cell wall mannoprotein CIS3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CIS3 PE=1 SV=1 62 161 9.0E-31
sp|P32478|HS150_YEAST Cell wall mannoprotein HSP150 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HSP150 PE=1 SV=2 67 160 7.0E-30
sp|B5VL26|HS150_YEAS6 Cell wall mannoprotein HSP150 OS=Saccharomyces cerevisiae (strain AWRI1631) GN=HSP150 PE=3 SV=1 67 160 8.0E-30
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|B5VL27|CIS3_YEAS6 Cell wall mannoprotein CIS3 OS=Saccharomyces cerevisiae (strain AWRI1631) GN=CIS3 PE=3 SV=1 62 161 4.0E-31
sp|A6ZQH4|CIS3_YEAS7 Cell wall mannoprotein CIS3 OS=Saccharomyces cerevisiae (strain YJM789) GN=CIS3 PE=3 SV=1 62 161 4.0E-31
sp|P47001|CIS3_YEAST Cell wall mannoprotein CIS3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CIS3 PE=1 SV=1 62 161 9.0E-31
sp|P32478|HS150_YEAST Cell wall mannoprotein HSP150 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HSP150 PE=1 SV=2 67 160 7.0E-30
sp|B5VL26|HS150_YEAS6 Cell wall mannoprotein HSP150 OS=Saccharomyces cerevisiae (strain AWRI1631) GN=HSP150 PE=3 SV=1 67 160 8.0E-30
sp|B3LPW4|HS150_YEAS1 Cell wall mannoprotein HSP150 OS=Saccharomyces cerevisiae (strain RM11-1a) GN=HSP150 PE=3 SV=1 67 160 1.0E-29
sp|A6ZQH3|HS150_YEAS7 Cell wall mannoprotein HSP150 OS=Saccharomyces cerevisiae (strain YJM789) GN=HSP150 PE=3 SV=1 67 160 1.0E-29
sp|Q03180|PIR3_YEAST Cell wall mannoprotein PIR3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PIR3 PE=1 SV=3 43 160 1.0E-29
sp|B3LQU1|PIR3_YEAS1 Cell wall mannoprotein PIR3 OS=Saccharomyces cerevisiae (strain RM11-1a) GN=PIR3 PE=3 SV=1 43 160 2.0E-29
sp|A6ZZG1|PIR3_YEAS7 Cell wall mannoprotein PIR3 OS=Saccharomyces cerevisiae (strain YJM789) GN=PIR3 PE=3 SV=1 43 160 2.0E-29
sp|A6ZZG0|PIR1_YEAS7 Cell wall mannoprotein PIR1 OS=Saccharomyces cerevisiae (strain YJM789) GN=PIR1 PE=3 SV=1 65 160 2.0E-28
sp|B3LQU0|PIR1_YEAS1 Cell wall mannoprotein PIR1 OS=Saccharomyces cerevisiae (strain RM11-1a) GN=PIR1 PE=3 SV=1 65 160 2.0E-28
sp|Q03178|PIR1_YEAST Cell wall mannoprotein PIR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PIR1 PE=1 SV=1 65 160 3.0E-28
sp|B5VL25|PIR5_YEAS6 Cell wall protein PIR5 OS=Saccharomyces cerevisiae (strain AWRI1631) GN=PIR5 PE=3 SV=1 59 156 5.0E-28
sp|B3LPW3|PIR5_YEAS1 Cell wall protein PIR5 OS=Saccharomyces cerevisiae (strain RM11-1a) GN=PIR5 PE=3 SV=1 59 156 5.0E-28
sp|P46999|PIR5_YEAST Cell wall protein PIR5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PIR5 PE=2 SV=2 59 156 5.0E-28
sp|A6ZQH2|PIR5_YEAS7 Cell wall protein PIR5 OS=Saccharomyces cerevisiae (strain YJM789) GN=PIR5 PE=3 SV=1 59 156 6.0E-27
sp|Q59PW0|PIR32_CANAL Probable cell wall mannoprotein PIR32 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PIR32 PE=2 SV=1 65 156 7.0E-24
sp|Q59SF7|PIR1_CANAL Cell wall mannoprotein PIR1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PIR1 PE=1 SV=1 67 156 1.0E-23
[Show less]

GO

GO Term Description Terminal node
GO:0005618 cell wall Yes
GO:0005199 structural constituent of cell wall Yes
GO:0005198 structural molecule activity No
GO:0030312 external encapsulating structure No
GO:0005575 cellular_component No
GO:0003674 molecular_function No
GO:0110165 cellular anatomical entity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 18 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|7122
MRWISLVPLALAATCRAANEDGPVTDLIKPQEQAPEGCKSDVDGRFQVTVKSLGSADGNDISKRSSSCGSDKTLV
MTLVGGVLTDAKNRTGYIASNRQFQFDGPPQSGAIYTGGFSLCGNGSLALGSSTVLYKCLSGDFSNLYDQHWAEQ
CSPVNMIAMDCEGGSDQGPSDGITVGTSMKATTLVTMLSDGQPQVVQTSVPIAMCQIGDGQVQVHTTPCDEAPHA
TQTSSQLPPVSQISDGQPQVPTSVSPLPPMSVSDTSVPETPAPETSASNTYVPEPSDIETYPSESSSGPYVPEPS
SEAPDTYVPQPSPAITSAPVVSSSAAPEATAPESRPPAKQSSSPQPQAPKATPTGSTLTAGAIKSLPGTAVAVVV
AAIGAIVGLC*
Coding >Hirsu2|7122
ATGAGATGGATTTCGCTGGTTCCCTTGGCCCTGGCAGCCACATGCCGGGCCGCGAATGAGGACGGTCCCGTCACC
GACTTGATCAAGCCCCAAGAACAGGCTCCCGAGGGCTGCAAGTCCGATGTCGACGGCAGATTTCAGGTCACCGTT
AAGTCCCTCGGCAGCGCCGATGGCAATGACATCAGCAAGCGGTCATCGTCATGCGGCAGCGATAAGACGCTGGTC
ATGACGCTGGTCGGAGGCGTCCTTACCGACGCCAAGAACCGCACCGGCTACATTGCCTCGAACCGCCAGTTTCAG
TTCGACGGGCCTCCTCAGTCCGGCGCCATCTACACTGGCGGCTTCTCCCTCTGCGGCAACGGCTCGCTGGCTCTC
GGCTCCTCCACCGTCCTCTACAAATGTCTGTCCGGCGACTTTTCCAACCTCTACGACCAGCACTGGGCCGAGCAG
TGCAGTCCCGTCAACATGATCGCCATGGACTGCGAGGGCGGCAGCGACCAAGGACCCAGCGACGGCATCACCGTC
GGCACGAGCATGAAGGCCACGACGCTGGTGACGATGCTGTCCGACGGCCAGCCGCAGGTCGTCCAGACCAGCGTC
CCCATTGCCATGTGCCAGATTGGCGACGGCCAGGTCCAGGTCCACACGACGCCCTGCGACGAGGCTCCCCATGCC
ACCCAGACCTCGTCTCAGTTGCCTCCCGTCTCCCAGATCTCCGACGGGCAGCCTCAGGTGCCCACGTCCGTCTCC
CCGCTGCCCCCTATGTCCGTGAGCGACACCAGCGTCCCCGAGACTCCTGCTCCCGAGACGTCGGCTTCGAACACC
TACGTCCCGGAGCCCTCCGACATCGAGACCTACCCCTCCGAGTCCTCCAGCGGCCCTTATGTCCCTGAACCGAGT
TCTGAAGCTCCGGACACCTATGTGCCGCAGCCTTCGCCGGCCATCACCTCGGCTCCGGTTGTCTCCTCGTCTGCG
GCCCCCGAAGCGACGGCCCCTGAGTCCCGCCCTCCGGCCAAGCAGAGCTCCAGCCCACAGCCCCAGGCCCCCAAG
GCAACACCTACCGGCAGCACCCTCACGGCTGGTGCTATCAAGTCTCTGCCCGGCACCGCAGTTGCCGTCGTCGTC
GCGGCCATCGGGGCCATCGTTGGCCTGTGCTAA
Transcript >Hirsu2|7122
ATGAGATGGATTTCGCTGGTTCCCTTGGCCCTGGCAGCCACATGCCGGGCCGCGAATGAGGACGGTCCCGTCACC
GACTTGATCAAGCCCCAAGAACAGGCTCCCGAGGGCTGCAAGTCCGATGTCGACGGCAGATTTCAGGTCACCGTT
AAGTCCCTCGGCAGCGCCGATGGCAATGACATCAGCAAGCGGTCATCGTCATGCGGCAGCGATAAGACGCTGGTC
ATGACGCTGGTCGGAGGCGTCCTTACCGACGCCAAGAACCGCACCGGCTACATTGCCTCGAACCGCCAGTTTCAG
TTCGACGGGCCTCCTCAGTCCGGCGCCATCTACACTGGCGGCTTCTCCCTCTGCGGCAACGGCTCGCTGGCTCTC
GGCTCCTCCACCGTCCTCTACAAATGTCTGTCCGGCGACTTTTCCAACCTCTACGACCAGCACTGGGCCGAGCAG
TGCAGTCCCGTCAACATGATCGCCATGGACTGCGAGGGCGGCAGCGACCAAGGACCCAGCGACGGCATCACCGTC
GGCACGAGCATGAAGGCCACGACGCTGGTGACGATGCTGTCCGACGGCCAGCCGCAGGTCGTCCAGACCAGCGTC
CCCATTGCCATGTGCCAGATTGGCGACGGCCAGGTCCAGGTCCACACGACGCCCTGCGACGAGGCTCCCCATGCC
ACCCAGACCTCGTCTCAGTTGCCTCCCGTCTCCCAGATCTCCGACGGGCAGCCTCAGGTGCCCACGTCCGTCTCC
CCGCTGCCCCCTATGTCCGTGAGCGACACCAGCGTCCCCGAGACTCCTGCTCCCGAGACGTCGGCTTCGAACACC
TACGTCCCGGAGCCCTCCGACATCGAGACCTACCCCTCCGAGTCCTCCAGCGGCCCTTATGTCCCTGAACCGAGT
TCTGAAGCTCCGGACACCTATGTGCCGCAGCCTTCGCCGGCCATCACCTCGGCTCCGGTTGTCTCCTCGTCTGCG
GCCCCCGAAGCGACGGCCCCTGAGTCCCGCCCTCCGGCCAAGCAGAGCTCCAGCCCACAGCCCCAGGCCCCCAAG
GCAACACCTACCGGCAGCACCCTCACGGCTGGTGCTATCAAGTCTCTGCCCGGCACCGCAGTTGCCGTCGTCGTC
GCGGCCATCGGGGCCATCGTTGGCCTGTGCTAA
Gene >Hirsu2|7122
ATGAGATGGATTTCGCTGGTTCCCTTGGCCCTGGCAGCCACATGCCGGGCCGCGAATGAGGACGGTCCCGTCACC
GACTTGATCAAGCCCCAAGAACAGGCTCCCGAGGGCTGCAAGTCCGATGTCGACGGCAGATTTCAGGTCACCGTT
AAGTCCCTCGGCAGCGCCGATGGCAATGACATCAGCGTGAGTCGTCCTCTCATACGGGTCCTCTGACCCGTGGCC
TGCATGTAGTCGTATTGGACAAAGGCATCTGACCCGGCTTCTTTTTGCAGAAGCGGTCATCGTCATGCGGCAGCG
ATAAGACGCTGGTCATGACGCTGGTCGGAGGCGTCCTTACCGACGCCAAGAACCGCACCGGCTACATTGCCTCGA
ACCGCCAGTTTCAGTTCGACGGGCCTCCTCAGTCCGGCGCCATCTACACTGGCGGCTTCTCCCTCTGCGGCAACG
GCTCGCTGGCTCTCGGCTCCTCCACCGTCCTCTACAAATGTCTGTCCGGCGACTTTTCCAACCTCTACGACCAGC
ACTGGGCCGAGCAGTGCAGTCCCGTCAACATGATCGCCATGGACTGCGAGGGCGGCAGCGACCAAGGACCCAGCG
ACGGCATCACCGTCGGCACGAGCATGAAGGCCACGACGCTGGTGACGATGCTGTCCGACGGCCAGCCGCAGGTCG
TCCAGACCAGCGTCCCCATTGCCATGTGCCAGATTGGCGACGGCCAGGTCCAGGTCCACACGACGCCCTGCGACG
AGGCTCCCCATGCCACCCAGACCTCGTCTCAGTTGCCTCCCGTCTCCCAGATCTCCGACGGGCAGCCTCAGGTGC
CCACGTCCGTCTCCCCGCTGCCCCCTATGTCCGTGAGCGACACCAGCGTCCCCGAGACTCCTGCTCCCGAGACGT
CGGCTTCGAACACCTACGTCCCGGAGCCCTCCGACATCGAGACCTACCCCTCCGAGTCCTCCAGCGGCCCTTATG
TCCCTGAACCGAGTTCTGAAGCTCCGGACACCTATGTGCCGCAGCCTTCGCCGGCCATCACCTCGGCTCCGGTTG
TCTCCTCGTCTGCGGCCCCCGAAGCGACGGCCCCTGAGTCCCGCCCTCCGGCCAAGCAGAGCTCCAGCCCACAGC
CCCAGGCCCCCAAGGCAACACCTACCGGCAGCACCCTCACGGCTGGTGCTATCAAGTCTCTGCCCGGCACCGCAG
TTGCCGTCGTCGTCGCGGCCATCGGGGCCATCGTTGGCCTGTGCTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail