Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|7114
Gene name
LocationContig_4:2213..4029
Strand-
Gene length (bp)1816
Transcript length (bp)1557
Coding sequence length (bp)1557
Protein length (aa) 519

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04820 Trp_halogenase Tryptophan halogenase 1.3E-10 54 305

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q0VZ69|THAL_CHOCO Tryptophan 2-halogenase OS=Chondromyces crocatus GN=cmdE PE=4 SV=1 1 340 4.0E-44

GO

GO Term Description Terminal node
GO:0004497 monooxygenase activity Yes
GO:0016491 oxidoreductase activity No
GO:0003674 molecular_function No
GO:0003824 catalytic activity No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm Peroxisomal targeting signal 0.5371 0.4133 0.1363 0.0344 0.2281 0.0723 0.0863 0.0849 0.1709 0.2406

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup339
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1109
Ophiocordyceps australis 1348a (Ghana) OphauG2|1662
Ophiocordyceps australis map64 (Brazil) OphauB2|588
Ophiocordyceps australis map64 (Brazil) OphauB2|6448
Ophiocordyceps camponoti-floridani Ophcf2|06233
Ophiocordyceps camponoti-rufipedis Ophun1|1945
Ophiocordyceps camponoti-rufipedis Ophun1|4166
Ophiocordyceps kimflemingae Ophio5|2110
Ophiocordyceps subramaniannii Hirsu2|4346
Ophiocordyceps subramaniannii Hirsu2|7114 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|7114
MLPSMKYFLEFIGLYETFNAHGFKKKNGASFRLNQSQPDAYTDFLAVGGPQGHAWNVIRSEADELLFQHAKVSGA
QTFDATKVEAICFEADNGFTTSGKEKQSPDPGRPTSATWTRTDGTSGVIKFDYLIDASGRNGLLCTKYLKNRKFN
QNLKNIAHWGYWKYGGTYGMGTHKEGCPHFEALEDASGWCWFIPLHDCTHSVGIVQNQQMAITKKRKMESDCTDG
SLSTREFYLRSTDLAPKIKQLLSAAELVTDIKSASDWSYSASTYAFPHARIVGDAGCFIDPFFSSGVHLATLGGL
SAAVTIAASYRGDCDELTAASWHTKKTTESYTRFFLVVSSALKQIRSQEEPVIQDVDEEGFQRAFDLFRPVIQGT
TDADASGKLSRSDISKTIEFCFKAFTHIAPEQKEALARKLKALGLDVVAEEATAKKMIEDIEKNLTSDEAQVLRV
LRSRRMIREDNFNIDSFTLDSIDGLAPNLERGKLGLIKAEKTVPDRSQTYSTRISIGAEQADSLDLLI*
Coding >Hirsu2|7114
ATGCTCCCGTCCATGAAATATTTCCTCGAATTTATAGGTCTCTATGAAACATTCAATGCTCACGGATTCAAGAAG
AAAAACGGTGCAAGTTTCCGGCTTAATCAATCTCAACCTGACGCCTATACGGATTTTCTTGCTGTGGGCGGCCCT
CAAGGACATGCGTGGAACGTGATCCGATCCGAGGCCGACGAACTTCTCTTCCAACATGCCAAGGTCAGCGGTGCA
CAAACTTTCGACGCTACTAAAGTCGAAGCTATATGTTTCGAGGCCGACAACGGGTTCACGACATCGGGGAAAGAA
AAGCAGTCTCCAGACCCAGGTCGACCGACATCCGCTACATGGACTCGTACAGACGGCACGTCCGGAGTCATCAAA
TTTGATTATCTCATAGACGCGAGCGGTCGGAACGGTTTGCTGTGTACCAAGTATCTGAAAAACCGAAAGTTCAAT
CAGAACCTGAAGAATATCGCTCACTGGGGCTACTGGAAGTATGGCGGCACGTATGGGATGGGGACACACAAAGAA
GGCTGTCCCCATTTCGAGGCGCTAGAGGACGCTAGTGGCTGGTGCTGGTTTATACCCCTCCACGACTGCACCCAC
TCTGTCGGCATCGTCCAGAACCAGCAGATGGCGATAACTAAGAAGCGAAAAATGGAATCTGATTGCACAGATGGG
AGTCTGTCTACCAGGGAGTTCTATCTGCGCTCAACCGACTTGGCTCCTAAGATAAAGCAACTGCTTTCTGCAGCA
GAATTAGTGACCGATATCAAATCAGCTTCTGACTGGTCCTACAGCGCATCGACGTATGCCTTTCCTCACGCGCGG
ATTGTGGGAGATGCTGGCTGTTTCATTGACCCCTTTTTTTCCTCCGGTGTGCACCTTGCCACCTTGGGTGGTCTA
TCGGCTGCCGTTACAATTGCAGCGTCTTACAGAGGTGACTGCGACGAGCTTACAGCGGCCTCTTGGCATACAAAG
AAGACGACTGAGAGTTATACCCGCTTCTTTCTGGTAGTCAGCAGTGCTCTTAAACAGATTCGATCCCAGGAGGAA
CCCGTGATTCAAGACGTTGACGAGGAGGGTTTTCAGAGAGCGTTCGATTTATTTCGTCCAGTCATTCAAGGCACT
ACGGACGCAGATGCCTCCGGGAAGCTGTCGCGATCCGATATCTCTAAGACTATTGAGTTTTGTTTTAAAGCCTTC
ACACACATTGCTCCAGAGCAGAAAGAAGCTCTTGCTCGGAAGCTGAAGGCTTTGGGCCTCGATGTTGTTGCAGAA
GAGGCGACTGCGAAGAAGATGATTGAAGATATCGAGAAGAATCTTACATCTGACGAGGCGCAAGTGCTAAGAGTC
TTGCGCAGCAGACGTATGATAAGAGAAGATAATTTCAATATCGACAGCTTTACTCTCGACTCTATCGACGGTCTA
GCGCCGAACCTGGAACGCGGTAAGCTCGGCCTGATCAAGGCGGAGAAGACAGTACCGGACAGGTCACAAACTTAC
TCTACGCGGATTTCGATTGGGGCAGAACAGGCTGATAGCCTGGATTTACTGATATAA
Transcript >Hirsu2|7114
ATGCTCCCGTCCATGAAATATTTCCTCGAATTTATAGGTCTCTATGAAACATTCAATGCTCACGGATTCAAGAAG
AAAAACGGTGCAAGTTTCCGGCTTAATCAATCTCAACCTGACGCCTATACGGATTTTCTTGCTGTGGGCGGCCCT
CAAGGACATGCGTGGAACGTGATCCGATCCGAGGCCGACGAACTTCTCTTCCAACATGCCAAGGTCAGCGGTGCA
CAAACTTTCGACGCTACTAAAGTCGAAGCTATATGTTTCGAGGCCGACAACGGGTTCACGACATCGGGGAAAGAA
AAGCAGTCTCCAGACCCAGGTCGACCGACATCCGCTACATGGACTCGTACAGACGGCACGTCCGGAGTCATCAAA
TTTGATTATCTCATAGACGCGAGCGGTCGGAACGGTTTGCTGTGTACCAAGTATCTGAAAAACCGAAAGTTCAAT
CAGAACCTGAAGAATATCGCTCACTGGGGCTACTGGAAGTATGGCGGCACGTATGGGATGGGGACACACAAAGAA
GGCTGTCCCCATTTCGAGGCGCTAGAGGACGCTAGTGGCTGGTGCTGGTTTATACCCCTCCACGACTGCACCCAC
TCTGTCGGCATCGTCCAGAACCAGCAGATGGCGATAACTAAGAAGCGAAAAATGGAATCTGATTGCACAGATGGG
AGTCTGTCTACCAGGGAGTTCTATCTGCGCTCAACCGACTTGGCTCCTAAGATAAAGCAACTGCTTTCTGCAGCA
GAATTAGTGACCGATATCAAATCAGCTTCTGACTGGTCCTACAGCGCATCGACGTATGCCTTTCCTCACGCGCGG
ATTGTGGGAGATGCTGGCTGTTTCATTGACCCCTTTTTTTCCTCCGGTGTGCACCTTGCCACCTTGGGTGGTCTA
TCGGCTGCCGTTACAATTGCAGCGTCTTACAGAGGTGACTGCGACGAGCTTACAGCGGCCTCTTGGCATACAAAG
AAGACGACTGAGAGTTATACCCGCTTCTTTCTGGTAGTCAGCAGTGCTCTTAAACAGATTCGATCCCAGGAGGAA
CCCGTGATTCAAGACGTTGACGAGGAGGGTTTTCAGAGAGCGTTCGATTTATTTCGTCCAGTCATTCAAGGCACT
ACGGACGCAGATGCCTCCGGGAAGCTGTCGCGATCCGATATCTCTAAGACTATTGAGTTTTGTTTTAAAGCCTTC
ACACACATTGCTCCAGAGCAGAAAGAAGCTCTTGCTCGGAAGCTGAAGGCTTTGGGCCTCGATGTTGTTGCAGAA
GAGGCGACTGCGAAGAAGATGATTGAAGATATCGAGAAGAATCTTACATCTGACGAGGCGCAAGTGCTAAGAGTC
TTGCGCAGCAGACGTATGATAAGAGAAGATAATTTCAATATCGACAGCTTTACTCTCGACTCTATCGACGGTCTA
GCGCCGAACCTGGAACGCGGTAAGCTCGGCCTGATCAAGGCGGAGAAGACAGTACCGGACAGGTCACAAACTTAC
TCTACGCGGATTTCGATTGGGGCAGAACAGGCTGATAGCCTGGATTTACTGATATAA
Gene >Hirsu2|7114
ATGCTCCCGTCCATGAAATATTTCCTCGAATTTATAGGTCTCTATGAAACATTCAATGCTCACGGATTCAAGAAG
AAAGTAAGGTCATGCTATACGTAGGATCAGACGCGACACAAGACTGACCCAACGACAGAACGGTGCAAGTTTCCG
GCTTAATCAATCTCAACCTGACGCCTGTGCGCTTCCGGTTTCTCTGCTTTTTGTCAATTTCGATAGCTAACCTCT
ACTCAAGATACGGATTTTCTTGCTGTGGGCGGCCCTCAAGGACATGCGTGGAACGTGATCCGATCCGAGGCCGAC
GAACTTCTCTTCCAACATGCCAAGGTCAGCGGTGCACAAACTTTCGACGCTACTAAAGTCGAAGCTATATGTTTC
GAGGCCGACAACGGGTTCACGACATCGGGGAAAGAAAAGCAGTCTCCAGACCCAGGTCGACCGACATCCGCTACA
TGGACTCGTACAGACGGCACGTCCGGAGTCATCAAATTTGATTATCTCATAGACGCGAGCGGTCGGAACGGTTTG
CTGTGTACCAAGTATCTGAAAAACCGAAAGTTCAATCAGAACCTGAAGAATATCGCTCACTGGGGCTACTGGAAG
TATGGCGGCACGTATGGGATGGGGACACACAAAGAAGGCTGTCCCCATTTCGAGGCGCTAGAGGGTACGTTAATG
TCGAGCGTCGAACACTCTCTCCGAGAGCCTTGTCAGCTGTCTATCTCACCGATTGACTGACTGCCTGGCTCTAGA
CGCTAGTGGCTGGTGCTGGTTTATACCCCTCCACGACTGCACCCACTCTGTCGGCATCGTCCAGAACCAGCAGAT
GGCGATAACTAAGAAGCGAAAAATGGAATCTGATTGCACAGATGGGAGTCTGTCTACCAGGGAGTTCTATCTGCG
CTCAACCGACTTGGCTCCTAAGATAAAGCAACTGCTTTCTGCAGCAGAATTAGTGACCGATATCAAATCAGCTTC
TGACTGGTCCTACAGCGCATCGACGTATGCCTTTCCTCACGCGCGGATTGTGGGAGATGCTGGCTGTTTCATTGA
CCCCTTTTTTTCCTCCGGTGTGCACCTTGCCACCTTGGGTGGTCTATCGGCTGCCGTTACAATTGCAGCGTCTTA
CAGAGGTGACTGCGACGAGCTTACAGCGGCCTCTTGGCATACAAAGAAGACGACTGAGAGTTATACCCGCTTCTT
TCTGGTAGTCAGCAGTGCTCTTAAACAGATTCGATCCCAGGAGGAACCCGTGATTCAAGACGTTGACGAGGAGGG
TTTTCAGAGAGCGTTCGATTTATTTCGTCCAGGTGAGATATTGCGACCCAACGATCTTTGTCTTGTTTCATTCTA
AACTCACTCGATGATTGCAGTCATTCAAGGCACTACGGACGCAGATGCCTCCGGGAAGCTGTCGCGATCCGATAT
CTCTAAGACTATTGAGTTTTGTTTTAAAGCCTTCACACACATTGCTCCAGAGCAGAAAGAAGCTCTTGCTCGGAA
GCTGAAGGCTTTGGGCCTCGATGTTGTTGCAGAAGAGGCGACTGCGAAGAAGATGATTGAAGATATCGAGAAGAA
TCTTACATCTGACGAGGCGCAAGTGCTAAGAGTCTTGCGCAGCAGACGTATGATAAGAGAAGATAATTTCAATAT
CGACAGCTTTACTCTCGACTCTATCGACGGTCTAGCGCCGAACCTGGAACGCGGTAAGCTCGGCCTGATCAAGGC
GGAGAAGACAGTACCGGACAGGTCACAAACTTACTCTACGCGGATTTCGATTGGGGCAGAACAGGCTGATAGCCT
GGATTTACTGATATAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail