Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|711
Gene name
LocationContig_1144:6573..7292
Strand-
Gene length (bp)719
Transcript length (bp)351
Coding sequence length (bp)351
Protein length (aa) 117

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01199 Ribosomal_L34e Ribosomal protein L34e 3.8E-44 1 95

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P40525|RL34B_YEAST 60S ribosomal protein L34-B OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPL34B PE=1 SV=1 2 109 9.0E-53
sp|P87262|RL34A_YEAST 60S ribosomal protein L34-A OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPL34A PE=1 SV=1 2 109 1.0E-52
sp|O42846|RL34A_SCHPO 60S ribosomal protein L34-A OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rpl3401 PE=3 SV=1 2 114 2.0E-48
sp|Q9URT8|RL34B_SCHPO 60S ribosomal protein L34-B OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rpl3402 PE=1 SV=1 2 111 4.0E-47
sp|Q54LV8|RL34_DICDI 60S ribosomal protein L34 OS=Dictyostelium discoideum GN=rpl34 PE=3 SV=1 4 106 3.0E-39
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P40525|RL34B_YEAST 60S ribosomal protein L34-B OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPL34B PE=1 SV=1 2 109 9.0E-53
sp|P87262|RL34A_YEAST 60S ribosomal protein L34-A OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPL34A PE=1 SV=1 2 109 1.0E-52
sp|O42846|RL34A_SCHPO 60S ribosomal protein L34-A OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rpl3401 PE=3 SV=1 2 114 2.0E-48
sp|Q9URT8|RL34B_SCHPO 60S ribosomal protein L34-B OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rpl3402 PE=1 SV=1 2 111 4.0E-47
sp|Q54LV8|RL34_DICDI 60S ribosomal protein L34 OS=Dictyostelium discoideum GN=rpl34 PE=3 SV=1 4 106 3.0E-39
sp|P49207|RL34_HUMAN 60S ribosomal protein L34 OS=Homo sapiens GN=RPL34 PE=1 SV=3 4 116 7.0E-38
sp|Q7ZWJ7|RL34_DANRE 60S ribosomal protein L34 OS=Danio rerio GN=rpl34 PE=3 SV=3 4 116 2.0E-37
sp|Q9D1R9|RL34_MOUSE 60S ribosomal protein L34 OS=Mus musculus GN=Rpl34 PE=1 SV=2 4 116 2.0E-37
sp|Q90YT5|RL34_ICTPU 60S ribosomal protein L34 OS=Ictalurus punctatus GN=rpl34 PE=3 SV=3 4 116 3.0E-37
sp|P40590|RL34_PEA 60S ribosomal protein L34 OS=Pisum sativum GN=RPL34 PE=2 SV=1 4 115 3.0E-36
sp|P41098|RL34_TOBAC 60S ribosomal protein L34 OS=Nicotiana tabacum GN=RPL34 PE=2 SV=1 4 114 5.0E-35
sp|Q9FE65|RL342_ARATH 60S ribosomal protein L34-2 OS=Arabidopsis thaliana GN=RPL34B PE=3 SV=1 4 114 8.0E-34
sp|Q42351|RL341_ARATH 60S ribosomal protein L34-1 OS=Arabidopsis thaliana GN=RPL34A PE=2 SV=1 4 114 1.0E-33
sp|P45842|RL34_AEDAL 60S ribosomal protein L34 OS=Aedes albopictus GN=RpL34 PE=2 SV=2 4 110 7.0E-33
sp|Q9NB34|RL34_OCHTR 60S ribosomal protein L34 OS=Ochlerotatus triseriatus GN=RpL34 PE=2 SV=3 4 110 1.0E-32
sp|Q9LJW6|RL343_ARATH 60S ribosomal protein L34-3 OS=Arabidopsis thaliana GN=RPL34C PE=2 SV=1 4 114 2.0E-32
sp|P0DJ23|RL34_TETTS 60S ribosomal protein L34 OS=Tetrahymena thermophila (strain SB210) GN=RPL34 PE=1 SV=1 2 104 2.0E-31
sp|Q29223|RL34_PIG 60S ribosomal protein L34 OS=Sus scrofa GN=RPL34 PE=3 SV=2 4 116 8.0E-31
sp|P11250|RL34_RAT 60S ribosomal protein L34 OS=Rattus norvegicus GN=Rpl34 PE=1 SV=3 4 116 4.0E-27
sp|Q1WBV0|RL34_VICPA 60S ribosomal protein L34 OS=Vicugna pacos GN=RPL34 PE=3 SV=1 4 116 4.0E-27
sp|Q8SSA2|RL34_ENCCU 60S ribosomal protein L34 OS=Encephalitozoon cuniculi (strain GB-M1) GN=RPL34 PE=1 SV=1 14 102 1.0E-15
sp|A2BME5|RL34_HYPBU 50S ribosomal protein L34e OS=Hyperthermus butylicus (strain DSM 5456 / JCM 9403 / PLM1-5) GN=rpl34e PE=3 SV=1 16 113 2.0E-10
sp|A6USC2|RL34_METVS 50S ribosomal protein L34e OS=Methanococcus vannielii (strain SB / ATCC 35089 / DSM 1224) GN=rpl34e PE=3 SV=1 22 91 2.0E-09
sp|A5UL62|RL34_METS3 50S ribosomal protein L34e OS=Methanobrevibacter smithii (strain PS / ATCC 35061 / DSM 861) GN=rpl34e PE=3 SV=1 12 90 1.0E-08
sp|O26137|RL34_METTH 50S ribosomal protein L34e OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=rpl34e PE=3 SV=1 14 87 7.0E-08
sp|A1RXV1|RL34_THEPD 50S ribosomal protein L34e OS=Thermofilum pendens (strain Hrk 5) GN=rpl34e PE=3 SV=1 11 100 3.0E-07
sp|Q8TZB2|RL34_METKA 50S ribosomal protein L34e OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=rpl34e PE=3 SV=1 14 90 3.0E-07
sp|B6YSP0|RL34_THEON 50S ribosomal protein L34e OS=Thermococcus onnurineus (strain NA1) GN=rpl34e PE=3 SV=1 14 90 9.0E-07
sp|Q9UZJ7|RL34_PYRAB 50S ribosomal protein L34e OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=rpl34e PE=3 SV=1 14 113 1.0E-06
sp|A3DND2|RL34_STAMF 50S ribosomal protein L34e OS=Staphylothermus marinus (strain ATCC 43588 / DSM 3639 / JCM 9404 / F1) GN=rpl34e PE=3 SV=1 16 92 1.0E-06
sp|Q5JJF7|RL34_THEKO 50S ribosomal protein L34e OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=rpl34e PE=3 SV=1 14 87 2.0E-06
sp|P54053|RL34_METJA 50S ribosomal protein L34e OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=rpl34e PE=3 SV=1 26 91 3.0E-06
sp|C5A259|RL34_THEGJ 50S ribosomal protein L34e OS=Thermococcus gammatolerans (strain DSM 15229 / JCM 11827 / EJ3) GN=rpl34e PE=3 SV=1 14 95 3.0E-06
sp|A6VJT2|RL34_METM7 50S ribosomal protein L34e OS=Methanococcus maripaludis (strain C7 / ATCC BAA-1331) GN=rpl34e PE=3 SV=1 14 91 4.0E-06
sp|Q8U2L3|RL34_PYRFU 50S ribosomal protein L34e OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=rpl34e PE=1 SV=1 14 113 4.0E-06
sp|A4FYK0|RL34_METM5 50S ribosomal protein L34e OS=Methanococcus maripaludis (strain C5 / ATCC BAA-1333) GN=rpl34e PE=3 SV=1 14 91 5.0E-06
sp|A9A697|RL34_METM6 50S ribosomal protein L34e OS=Methanococcus maripaludis (strain C6 / ATCC BAA-1332) GN=rpl34e PE=3 SV=1 14 91 5.0E-06
sp|C6A186|RL34_THESM 50S ribosomal protein L34e OS=Thermococcus sibiricus (strain MM 739 / DSM 12597) GN=rpl34e PE=3 SV=1 14 93 6.0E-06
sp|O74006|RL34_PYRHO 50S ribosomal protein L34e OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=rpl34e PE=3 SV=2 14 113 8.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0006412 translation Yes
GO:0003735 structural constituent of ribosome Yes
GO:0005840 ribosome Yes
GO:0034645 cellular macromolecule biosynthetic process No
GO:0008150 biological_process No
GO:0043228 non-membrane-bounded organelle No
GO:0009058 biosynthetic process No
GO:0044249 cellular biosynthetic process No
GO:0043226 organelle No
GO:0043232 intracellular non-membrane-bounded organelle No
GO:0019538 protein metabolic process No
GO:0044271 cellular nitrogen compound biosynthetic process No
GO:0071704 organic substance metabolic process No
GO:0008152 metabolic process No
GO:0009059 macromolecule biosynthetic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0043229 intracellular organelle No
GO:0044260 cellular macromolecule metabolic process No
GO:0009987 cellular process No
GO:0043043 peptide biosynthetic process No
GO:0005198 structural molecule activity No
GO:0006807 nitrogen compound metabolic process No
GO:0043603 cellular amide metabolic process No
GO:0044238 primary metabolic process No
GO:1901566 organonitrogen compound biosynthetic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0110165 cellular anatomical entity No
GO:0003674 molecular_function No
GO:1901576 organic substance biosynthetic process No
GO:0005575 cellular_component No
GO:0044237 cellular metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0006518 peptide metabolic process No
GO:0043604 amide biosynthetic process No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm 0.5863 0.3656 0.0102 0.0652 0.38 0.0458 0.361 0.1001 0.0185 0.0064

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup5554
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4508
Ophiocordyceps australis map64 (Brazil) OphauB2|3356
Ophiocordyceps camponoti-floridani Ophcf2|01764
Ophiocordyceps camponoti-rufipedis Ophun1|1002
Ophiocordyceps kimflemingae Ophio5|4965
Ophiocordyceps subramaniannii Hirsu2|711 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|711
MVSQRVTYRRRNPYNTRSNRTRVIKTPGGELRLLHIKKRGTVPKCGDCGSKLSGIPALRPREYANISKPKKTVQR
AYGGSRCGGCVRDRIVRAFLIEEQKIVKKVLKEQEQSQKKK*
Coding >Hirsu2|711
ATGGTGTCCCAACGAGTTACCTATCGCCGCCGCAACCCCTACAACACTCGATCCAACCGGACCCGAGTCATCAAG
ACTCCCGGTGGTGAGCTTCGACTACTGCACATCAAGAAGCGCGGCACTGTTCCCAAGTGCGGCGACTGCGGCTCC
AAGCTGTCCGGCATCCCTGCCCTACGACCACGCGAGTATGCCAATATCTCAAAGCCCAAGAAGACTGTCCAGCGA
GCCTACGGAGGATCGAGATGCGGTGGCTGCGTCCGCGACCGTATCGTCCGAGCTTTCCTCATTGAGGAGCAGAAG
ATTGTCAAGAAGGTGCTGAAGGAGCAGGAGCAGAGCCAGAAGAAGAAATAG
Transcript >Hirsu2|711
ATGGTGTCCCAACGAGTTACCTATCGCCGCCGCAACCCCTACAACACTCGATCCAACCGGACCCGAGTCATCAAG
ACTCCCGGTGGTGAGCTTCGACTACTGCACATCAAGAAGCGCGGCACTGTTCCCAAGTGCGGCGACTGCGGCTCC
AAGCTGTCCGGCATCCCTGCCCTACGACCACGCGAGTATGCCAATATCTCAAAGCCCAAGAAGACTGTCCAGCGA
GCCTACGGAGGATCGAGATGCGGTGGCTGCGTCCGCGACCGTATCGTCCGAGCTTTCCTCATTGAGGAGCAGAAG
ATTGTCAAGAAGGTGCTGAAGGAGCAGGAGCAGAGCCAGAAGAAGAAATAG
Gene >Hirsu2|711
ATGGTGTCCCAACGAGTTACCTATCGCCGCCGCAACCCGTGAGTGCCCTTGCTGTCAAATCACTCGACTTGTCCG
CCTTAAATACCGCACTCGAGCGCAGTCAAAGAAATGTCGGCCATCGGCTGACAGGACCTGTGCAGCTACAACACT
CGATCCAACCGGACCCGAGTCATCAAGACTCCCGGTGGTGAGCTTCGACTACTGCACATCAAGAAGCGCGGCACT
GTTCCCAAGTGCGGCGACTGCGGCTCCAAGCTGTCCGGCGTAAGTGCCCCCTCAATGATTTTCAGCGAGGCAATT
GGTGGCGGGAGAGACGTGCGAGGTCCAACGAACGGCCCTGCCGGGCCTCAACGGAGAAACCAACAAGACAGGCAT
ACGGCTACTTTTTTTTTGCGTACCTGTGCTGCCATTGAGCATCGCCATCGAAGAGGACGGAGCAGTCGGCCGTGA
AACGGTCGAAGCCCGGCCTCACTCCAAGTGCCGCGCACAACTCATACACACACAAGTACTGACTGGAGACAAACG
ACTAGATCCCTGCCCTACGACCACGCGAGTATGCCAATATCTCAAAGCCCAAGAAGACTGTCCAGCGAGCCTACG
GAGGATCGAGATGCGGTGGCTGCGTCCGCGACCGTATCGTCCGAGCTTTCCTCATTGAGGAGCAGAAGATTGTCA
AGAAGGTGCTGAAGGAGCAGGAGCAGAGCCAGAAGAAGAAATAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail