Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|7109
Gene name
LocationContig_399:8654..11985
Strand+
Gene length (bp)3331
Transcript length (bp)3027
Coding sequence length (bp)3027
Protein length (aa) 1009

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF15411 PH_10 Pleckstrin homology domain 5.9E-40 435 553
PF06395 CDC24 CDC24 Calponin 1.9E-32 116 204
PF00621 RhoGEF RhoGEF domain 8.9E-28 239 407
PF00564 PB1 PB1 domain 1.1E-07 924 986

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P40995|SCD1_SCHPO Rho guanine nucleotide exchange factor scd1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=scd1 PE=1 SV=2 87 555 5.0E-73
sp|P11433|CDC24_YEAST Cell division control protein 24 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CDC24 PE=1 SV=2 116 479 2.0E-46
sp|Q8IVF5|TIAM2_HUMAN T-lymphoma invasion and metastasis-inducing protein 2 OS=Homo sapiens GN=TIAM2 PE=2 SV=4 239 480 4.0E-19
sp|Q6ZPF3|TIAM2_MOUSE T-lymphoma invasion and metastasis-inducing protein 2 OS=Mus musculus GN=Tiam2 PE=1 SV=2 239 480 7.0E-19
sp|Q3LAC4|PREX2_MOUSE Phosphatidylinositol 3,4,5-trisphosphate-dependent Rac exchanger 2 protein OS=Mus musculus GN=Prex2 PE=1 SV=2 229 560 9.0E-19
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P40995|SCD1_SCHPO Rho guanine nucleotide exchange factor scd1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=scd1 PE=1 SV=2 87 555 5.0E-73
sp|P11433|CDC24_YEAST Cell division control protein 24 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CDC24 PE=1 SV=2 116 479 2.0E-46
sp|Q8IVF5|TIAM2_HUMAN T-lymphoma invasion and metastasis-inducing protein 2 OS=Homo sapiens GN=TIAM2 PE=2 SV=4 239 480 4.0E-19
sp|Q6ZPF3|TIAM2_MOUSE T-lymphoma invasion and metastasis-inducing protein 2 OS=Mus musculus GN=Tiam2 PE=1 SV=2 239 480 7.0E-19
sp|Q3LAC4|PREX2_MOUSE Phosphatidylinositol 3,4,5-trisphosphate-dependent Rac exchanger 2 protein OS=Mus musculus GN=Prex2 PE=1 SV=2 229 560 9.0E-19
sp|Q70Z35|PREX2_HUMAN Phosphatidylinositol 3,4,5-trisphosphate-dependent Rac exchanger 2 protein OS=Homo sapiens GN=PREX2 PE=2 SV=1 229 560 5.0E-18
sp|Q13009|TIAM1_HUMAN T-lymphoma invasion and metastasis-inducing protein 1 OS=Homo sapiens GN=TIAM1 PE=1 SV=2 218 480 3.0E-17
sp|Q69ZK0|PREX1_MOUSE Phosphatidylinositol 3,4,5-trisphosphate-dependent Rac exchanger 1 protein OS=Mus musculus GN=Prex1 PE=1 SV=2 232 560 4.0E-17
sp|Q60610|TIAM1_MOUSE T-lymphoma invasion and metastasis-inducing protein 1 OS=Mus musculus GN=Tiam1 PE=1 SV=1 228 480 1.0E-16
sp|Q9ULL1|PKHG1_HUMAN Pleckstrin homology domain-containing family G member 1 OS=Homo sapiens GN=PLEKHG1 PE=1 SV=2 224 477 2.0E-16
sp|P91621|SIF1_DROME Protein still life, isoform SIF type 1 OS=Drosophila melanogaster GN=sif PE=2 SV=2 239 408 2.0E-16
sp|P91620|SIF2_DROME Protein still life, isoforms C/SIF type 2 OS=Drosophila melanogaster GN=sif PE=2 SV=2 239 408 4.0E-16
sp|A1L390|PKHG3_HUMAN Pleckstrin homology domain-containing family G member 3 OS=Homo sapiens GN=PLEKHG3 PE=1 SV=1 218 473 4.0E-16
sp|Q1LUA6|TRIO_DANRE Triple functional domain protein OS=Danio rerio GN=trio PE=3 SV=1 236 482 5.0E-16
sp|Q4VAC9|PKHG3_MOUSE Pleckstrin homology domain-containing family G member 3 OS=Mus musculus GN=Plekhg3 PE=1 SV=2 232 473 5.0E-16
sp|Q8TCU6|PREX1_HUMAN Phosphatidylinositol 3,4,5-trisphosphate-dependent Rac exchanger 1 protein OS=Homo sapiens GN=PREX1 PE=1 SV=3 232 560 1.0E-15
sp|A2CG49|KALRN_MOUSE Kalirin OS=Mus musculus GN=Kalrn PE=1 SV=1 236 473 3.0E-15
sp|P97924|KALRN_RAT Kalirin OS=Rattus norvegicus GN=Kalrn PE=1 SV=3 236 473 3.0E-15
sp|O75962|TRIO_HUMAN Triple functional domain protein OS=Homo sapiens GN=TRIO PE=1 SV=2 236 482 3.0E-15
sp|O60229|KALRN_HUMAN Kalirin OS=Homo sapiens GN=KALRN PE=1 SV=2 236 473 3.0E-15
sp|Q0KL02|TRIO_MOUSE Triple functional domain protein OS=Mus musculus GN=Trio PE=1 SV=3 236 482 4.0E-15
sp|O75962|TRIO_HUMAN Triple functional domain protein OS=Homo sapiens GN=TRIO PE=1 SV=2 220 469 5.0E-14
sp|Q0KL02|TRIO_MOUSE Triple functional domain protein OS=Mus musculus GN=Trio PE=1 SV=3 220 469 5.0E-14
sp|O15068|MCF2L_HUMAN Guanine nucleotide exchange factor DBS OS=Homo sapiens GN=MCF2L PE=1 SV=2 236 450 8.0E-13
sp|Q63406|MCF2L_RAT Guanine nucleotide exchange factor DBS OS=Rattus norvegicus GN=Mcf2l PE=1 SV=3 236 450 2.0E-12
sp|A2CG49|KALRN_MOUSE Kalirin OS=Mus musculus GN=Kalrn PE=1 SV=1 218 469 6.0E-12
sp|P97924|KALRN_RAT Kalirin OS=Rattus norvegicus GN=Kalrn PE=1 SV=3 218 469 6.0E-12
sp|O60229|KALRN_HUMAN Kalirin OS=Homo sapiens GN=KALRN PE=1 SV=2 220 469 7.0E-12
sp|Q5DU57|SPT13_MOUSE Spermatogenesis-associated protein 13 OS=Mus musculus GN=Spata13 PE=1 SV=2 231 473 2.0E-11
sp|Q96N96|SPT13_HUMAN Spermatogenesis-associated protein 13 OS=Homo sapiens GN=SPATA13 PE=1 SV=1 236 473 5.0E-11
sp|Q1LUA6|TRIO_DANRE Triple functional domain protein OS=Danio rerio GN=trio PE=3 SV=1 236 469 7.0E-11
sp|Q64096|MCF2L_MOUSE Guanine nucleotide exchange factor DBS OS=Mus musculus GN=Mcf2l PE=1 SV=2 236 450 8.0E-11
sp|Q9H7P9|PKHG2_HUMAN Pleckstrin homology domain-containing family G member 2 OS=Homo sapiens GN=PLEKHG2 PE=1 SV=3 234 442 1.0E-10
sp|Q80U35|ARHGH_MOUSE Rho guanine nucleotide exchange factor 17 OS=Mus musculus GN=Arhgef17 PE=1 SV=2 232 515 3.0E-10
sp|Q96PE2|ARHGH_HUMAN Rho guanine nucleotide exchange factor 17 OS=Homo sapiens GN=ARHGEF17 PE=1 SV=1 232 470 3.0E-10
sp|Q45FX5|VAV_CAEEL Protein vav-1 OS=Caenorhabditis elegans GN=vav-1 PE=1 SV=1 236 475 5.0E-10
sp|Q14155|ARHG7_HUMAN Rho guanine nucleotide exchange factor 7 OS=Homo sapiens GN=ARHGEF7 PE=1 SV=2 228 469 2.0E-09
sp|Q9NR80|ARHG4_HUMAN Rho guanine nucleotide exchange factor 4 OS=Homo sapiens GN=ARHGEF4 PE=1 SV=3 228 473 2.0E-09
sp|Q96PX9|PKH4B_HUMAN Pleckstrin homology domain-containing family G member 4B OS=Homo sapiens GN=PLEKHG4B PE=2 SV=4 206 481 2.0E-09
sp|Q5JSP0|FGD3_HUMAN FYVE, RhoGEF and PH domain-containing protein 3 OS=Homo sapiens GN=FGD3 PE=1 SV=1 238 471 4.0E-09
sp|Q9Z1I6|ARHG1_RAT Rho guanine nucleotide exchange factor 1 OS=Rattus norvegicus GN=Arhgef1 PE=2 SV=1 236 416 6.0E-09
sp|O88842|FGD3_MOUSE FYVE, RhoGEF and PH domain-containing protein 3 OS=Mus musculus GN=Fgd3 PE=1 SV=1 238 515 6.0E-09
sp|Q6KAU7|PKHG2_MOUSE Pleckstrin homology domain-containing family G member 2 OS=Mus musculus GN=Plekhg2 PE=2 SV=2 234 443 7.0E-09
sp|Q5R5T1|FGD3_PONAB FYVE, RhoGEF and PH domain-containing protein 3 OS=Pongo abelii GN=FGD3 PE=2 SV=1 238 471 1.0E-08
sp|O88387|FGD4_RAT FYVE, RhoGEF and PH domain-containing protein 4 OS=Rattus norvegicus GN=Fgd4 PE=1 SV=1 239 471 1.0E-08
sp|Q96M96|FGD4_HUMAN FYVE, RhoGEF and PH domain-containing protein 4 OS=Homo sapiens GN=FGD4 PE=1 SV=2 239 471 1.0E-08
sp|Q54J11|GXCI_DICDI RhoGEF domain-containing protein gxcI OS=Dictyostelium discoideum GN=gxcI PE=3 SV=3 227 406 2.0E-08
sp|Q92888|ARHG1_HUMAN Rho guanine nucleotide exchange factor 1 OS=Homo sapiens GN=ARHGEF1 PE=1 SV=2 236 416 2.0E-08
sp|Q7TNR9|ARHG4_MOUSE Rho guanine nucleotide exchange factor 4 OS=Mus musculus GN=Arhgef4 PE=2 SV=2 236 473 2.0E-08
sp|Q8BY35|FGD2_MOUSE FYVE, RhoGEF and PH domain-containing protein 2 OS=Mus musculus GN=Fgd2 PE=1 SV=1 225 471 2.0E-08
sp|Q08DN7|VAV_BOVIN Proto-oncogene vav OS=Bos taurus GN=VAV1 PE=2 SV=1 213 477 2.0E-08
sp|P54100|VAV_RAT Proto-oncogene vav OS=Rattus norvegicus GN=Vav1 PE=2 SV=1 213 472 2.0E-08
sp|Q91ZT5|FGD4_MOUSE FYVE, RhoGEF and PH domain-containing protein 4 OS=Mus musculus GN=Fgd4 PE=1 SV=1 239 471 2.0E-08
sp|Q5ZLR6|ARHG6_CHICK Rho guanine nucleotide exchange factor 6 OS=Gallus gallus GN=ARHGEF6 PE=2 SV=1 234 469 2.0E-08
sp|O94827|PKHG5_HUMAN Pleckstrin homology domain-containing family G member 5 OS=Homo sapiens GN=PLEKHG5 PE=1 SV=3 229 443 3.0E-08
sp|Q61210|ARHG1_MOUSE Rho guanine nucleotide exchange factor 1 OS=Mus musculus GN=Arhgef1 PE=1 SV=2 236 416 4.0E-08
sp|P15498|VAV_HUMAN Proto-oncogene vav OS=Homo sapiens GN=VAV1 PE=1 SV=4 213 472 5.0E-08
sp|Q8R0J1|PKHG6_MOUSE Pleckstrin homology domain-containing family G member 6 OS=Mus musculus GN=Plekhg6 PE=2 SV=2 213 472 9.0E-08
sp|Q6TXD4|DNMBP_MOUSE Dynamin-binding protein OS=Mus musculus GN=Dnmbp PE=1 SV=2 233 383 9.0E-08
sp|Q9TW28|MYOM_DICDI Myosin-M heavy chain OS=Dictyostelium discoideum GN=myoM PE=1 SV=1 235 471 1.0E-07
sp|P27870|VAV_MOUSE Proto-oncogene vav OS=Mus musculus GN=Vav1 PE=1 SV=1 227 472 1.0E-07
sp|Q6XZF7|DNMBP_HUMAN Dynamin-binding protein OS=Homo sapiens GN=DNMBP PE=1 SV=1 233 383 2.0E-07
sp|Q5RDK0|ARHG9_PONAB Rho guanine nucleotide exchange factor 9 OS=Pongo abelii GN=ARHGEF9 PE=2 SV=1 236 383 2.0E-07
sp|Q86VW2|ARHGP_HUMAN Rho guanine nucleotide exchange factor 25 OS=Homo sapiens GN=ARHGEF25 PE=1 SV=2 214 469 2.0E-07
sp|Q58DL7|ARHG9_BOVIN Rho guanine nucleotide exchange factor 9 OS=Bos taurus GN=ARHGEF9 PE=2 SV=1 236 473 2.0E-07
sp|P52734|FGD1_MOUSE FYVE, RhoGEF and PH domain-containing protein 1 OS=Mus musculus GN=Fgd1 PE=1 SV=2 238 471 3.0E-07
sp|P98174|FGD1_HUMAN FYVE, RhoGEF and PH domain-containing protein 1 OS=Homo sapiens GN=FGD1 PE=1 SV=2 238 471 3.0E-07
sp|Q9QX73|ARHG9_RAT Rho guanine nucleotide exchange factor 9 OS=Rattus norvegicus GN=Arhgef9 PE=1 SV=1 236 383 4.0E-07
sp|Q6RFZ7|PKHG5_RAT Pleckstrin homology domain-containing family G member 5 OS=Rattus norvegicus GN=Plekhg5 PE=1 SV=1 321 443 5.0E-07
sp|Q54B37|GXCJ_DICDI RhoGEF domain-containing protein gxcJ OS=Dictyostelium discoideum GN=gxcJ PE=3 SV=1 235 407 5.0E-07
sp|Q3UTH8|ARHG9_MOUSE Rho guanine nucleotide exchange factor 9 OS=Mus musculus GN=Arhgef9 PE=1 SV=1 236 473 5.0E-07
sp|O43307|ARHG9_HUMAN Rho guanine nucleotide exchange factor 9 OS=Homo sapiens GN=ARHGEF9 PE=1 SV=3 236 473 5.0E-07
sp|Q66T02|PKHG5_MOUSE Pleckstrin homology domain-containing family G member 5 OS=Mus musculus GN=Plekhg5 PE=1 SV=1 321 443 7.0E-07
sp|P10911|MCF2_HUMAN Proto-oncogene DBL OS=Homo sapiens GN=MCF2 PE=1 SV=3 236 451 8.0E-07
sp|Q9UKW4|VAV3_HUMAN Guanine nucleotide exchange factor VAV3 OS=Homo sapiens GN=VAV3 PE=1 SV=1 236 472 9.0E-07
sp|Q60992|VAV2_MOUSE Guanine nucleotide exchange factor VAV2 OS=Mus musculus GN=Vav2 PE=1 SV=1 236 472 1.0E-06
sp|Q9R0C8|VAV3_MOUSE Guanine nucleotide exchange factor VAV3 OS=Mus musculus GN=Vav3 PE=1 SV=2 236 472 1.0E-06
sp|Q9UTR5|RGF2_SCHPO Rho1 guanine nucleotide exchange factor 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rgf2 PE=1 SV=1 236 472 2.0E-06
sp|Q80VK6|ARH38_MOUSE Rho guanine nucleotide exchange factor 38 OS=Mus musculus GN=Arhgef38 PE=1 SV=2 218 383 2.0E-06
sp|P52735|VAV2_HUMAN Guanine nucleotide exchange factor VAV2 OS=Homo sapiens GN=VAV2 PE=1 SV=2 236 472 3.0E-06
sp|Q9NZM3|ITSN2_HUMAN Intersectin-2 OS=Homo sapiens GN=ITSN2 PE=1 SV=3 236 426 5.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0035023 regulation of Rho protein signal transduction Yes
GO:0005515 protein binding Yes
GO:0005089 Rho guanyl-nucleotide exchange factor activity Yes
GO:0005088 Ras guanyl-nucleotide exchange factor activity No
GO:0098772 molecular function regulator No
GO:0009966 regulation of signal transduction No
GO:0003674 molecular_function No
GO:0023051 regulation of signaling No
GO:0046578 regulation of Ras protein signal transduction No
GO:0008150 biological_process No
GO:0017016 Ras GTPase binding No
GO:0005488 binding No
GO:0050794 regulation of cellular process No
GO:1902531 regulation of intracellular signal transduction No
GO:0048583 regulation of response to stimulus No
GO:0019899 enzyme binding No
GO:0005085 guanyl-nucleotide exchange factor activity No
GO:0065007 biological regulation No
GO:0051020 GTPase binding No
GO:0010646 regulation of cell communication No
GO:0031267 small GTPase binding No
GO:0050789 regulation of biological process No
GO:0051056 regulation of small GTPase mediated signal transduction No
GO:0017048 Rho GTPase binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 25 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|7109
MAHAPLLRNNTAPVFEPSLSGARGLPPNRMSNAPRTSQLSGSTAYAGSSSSSLNSLTSGGTVVPGPNGGPVIATA
NIINQKADASRSLYQICISLKQRLAQVPGFEPFLDQLDPTDPVDPLWNLFRTGYPLLAIYNSLQPAEPLKVDDAN
ANEAKKSKIAIFKFVQACMKELRVSPTESFVITDLMGNDTSGFVKVTQVVNYVLDLAENRGLLLQSQPYPEDELA
NPAVASQMSYRDHIVKELVDTERKYVQDLENLHDLKKALEQKGAVPGDIVHQIFLNINAILDFQRRFLIRVETTN
SMPKTVQRWGAPFRFYEDAFDIYQPFIANQRKAAQIANQVFDKIQLSDHPVAADFNTLDGFLLKPMQRLVKYPLL
LKDLHKKTEDPEIKEDLMLGCEAAERVLHKANEAVNRDLLDEALEELIGRVDDWKSHKVESFGKLLLHGVYGVIT
GKSEQEKEYEIYLFECILLCCKEASTTKSKDRRDKSRSSGPKLRNRHAKLQLKGRIFMTNVTDIVSLSKPGSHSV
QIWWKGDPGVENFTIKFLQEETMKKWAAGLETQRKDNVPRPSTSPDGLATDFSWTRDQVGGLENPYLTQDDEDDE
DYGPLAAPAQFPMSVQGMPRRPSTSNLRQRSATGESSQSLAGIARAPPSRFPMPMPLPVPTPLSVQTQSNGALSP
GTRIGDSYFSPVADSPASSRTSAASGMFPGPPYSFTKSGTPQPGWDDSNRYTAPAMPRAPSRDGNSPNPHGHRNP
RGPSLPAMATQSQSAAQQQRSRSYSTPDVNATGIPRQRQPSQGQVPAVPGIPQHLHPAHDSNIPRSQTGSPRGEL
PIRTSTQSPGARDRLHKHSGSLGGTMTHFPSQPAYSRQNTPGPPGGTNGLRVDSASANSRTVSPALGTGTVAAPP
AGNEMAMPTQLKVRVNCDSGNYVTLVVAFNITYQSLIDRIDAKLARFMNSSISKGMLKLRYRDEDGDFVTIESDD
DIQIAFMEWREGLRNMYSAGVGEIELFCVGETS*
Coding >Hirsu2|7109
ATGGCCCATGCCCCGTTACTCAGAAACAACACCGCCCCGGTCTTCGAGCCCAGCCTGAGCGGCGCCCGAGGCCTG
CCACCGAACAGGATGAGCAATGCGCCGCGCACCAGCCAGTTGTCGGGCTCGACGGCCTACGCTGGCTCCTCGTCC
TCGTCGCTCAACTCCCTCACCAGCGGCGGCACCGTCGTGCCCGGCCCCAACGGCGGCCCCGTCATAGCCACCGCC
AACATCATCAACCAAAAGGCCGACGCCTCCCGCTCCCTCTACCAGATATGCATCTCCCTCAAGCAGCGCCTCGCC
CAGGTGCCCGGCTTCGAGCCCTTCCTCGACCAGCTCGACCCCACCGACCCCGTCGATCCGCTCTGGAACCTCTTC
CGCACCGGCTACCCCCTCCTGGCCATCTACAACTCGCTGCAGCCCGCCGAGCCGCTCAAGGTCGACGACGCCAAC
GCCAACGAGGCCAAGAAGTCCAAGATCGCCATCTTCAAGTTCGTCCAGGCCTGCATGAAGGAGCTCCGGGTGTCG
CCGACCGAGAGCTTCGTCATCACCGATCTGATGGGCAACGACACCAGCGGCTTCGTCAAGGTGACGCAAGTCGTC
AATTACGTGCTCGACCTCGCCGAGAACCGCGGTCTCCTGCTGCAAAGTCAACCGTACCCGGAAGACGAACTCGCG
AACCCCGCCGTCGCCTCGCAGATGAGCTACCGAGACCACATCGTCAAGGAGCTGGTCGACACGGAGCGCAAGTAC
GTGCAGGACCTGGAAAACCTCCACGACCTGAAAAAGGCCCTGGAGCAAAAGGGCGCCGTGCCCGGCGACATTGTC
CACCAGATCTTCCTCAACATCAACGCCATCCTCGACTTCCAGCGCCGGTTCCTCATCCGCGTCGAAACGACAAAC
TCGATGCCCAAGACGGTCCAGCGCTGGGGCGCGCCCTTCCGCTTCTACGAAGATGCCTTTGACATCTACCAGCCC
TTCATCGCCAACCAGCGCAAGGCGGCCCAGATCGCGAACCAGGTCTTCGACAAGATCCAGCTCTCCGACCACCCC
GTCGCCGCCGACTTCAACACCCTCGACGGCTTCCTGCTCAAGCCCATGCAGCGCCTGGTCAAGTACCCGCTGCTC
CTCAAGGACCTTCACAAGAAGACCGAAGATCCCGAGATCAAGGAGGACCTCATGCTGGGCTGCGAAGCCGCCGAG
CGGGTTCTGCACAAGGCCAACGAGGCCGTCAACCGAGACTTGCTGGACGAAGCCCTCGAGGAGCTGATCGGCAGA
GTGGACGACTGGAAGTCTCATAAGGTGGAGTCGTTCGGGAAGCTGCTCCTGCACGGCGTCTACGGCGTCATCACC
GGCAAAAGCGAGCAGGAGAAGGAGTACGAGATATACCTGTTCGAGTGCATCCTGCTCTGCTGCAAGGAGGCCTCC
ACCACCAAGAGCAAGGACAGAAGGGACAAGAGCCGGTCCTCGGGTCCCAAGCTTCGCAACCGCCACGCCAAGCTC
CAGCTAAAGGGCAGGATATTCATGACTAACGTGACTGACATCGTGTCTCTTTCCAAGCCCGGATCCCACAGCGTC
CAGATCTGGTGGAAAGGCGACCCCGGCGTCGAAAACTTCACCATCAAGTTCCTGCAAGAGGAGACGATGAAGAAG
TGGGCGGCCGGGCTCGAGACGCAGCGCAAGGACAACGTCCCGCGCCCATCGACGAGTCCGGACGGCCTCGCCACC
GACTTTTCGTGGACGCGGGACCAGGTCGGCGGGCTCGAGAACCCGTACCTGACACAGGATGACGAGGACGACGAA
GACTACGGCCCGCTGGCCGCCCCCGCGCAGTTCCCCATGTCCGTGCAGGGGATGCCGCGCCGGCCCTCGACGTCG
AACCTGAGGCAGCGGTCCGCCACGGGCGAGAGCTCCCAGTCGCTGGCCGGCATCGCCCGCGCGCCGCCGTCGCGG
TTCCCGATGCCGATGCCCCTGCCGGTCCCGACGCCGCTGAGCGTCCAGACGCAGAGCAACGGCGCGCTGTCGCCC
GGAACCAGGATCGGCGACAGCTACTTCTCCCCCGTCGCCGACTCGCCCGCCTCGTCGCGGACCAGCGCCGCGAGC
GGCATGTTCCCCGGCCCCCCCTACTCCTTCACCAAGTCGGGCACGCCGCAGCCGGGGTGGGACGACAGCAACCGG
TACACGGCGCCGGCCATGCCCCGGGCGCCGTCGCGCGACGGCAACTCGCCGAACCCGCACGGGCACCGGAACCCC
CGCGGGCCGTCGCTGCCCGCCATGGCGACGCAGAGCCAGAGCGCGGCCCAGCAGCAGAGGAGTCGGTCGTACAGC
ACGCCCGACGTCAACGCGACGGGGATCCCGCGGCAGCGGCAGCCCAGCCAGGGCCAGGTGCCGGCCGTGCCGGGC
ATCCCGCAACACCTCCACCCGGCGCACGACTCCAACATCCCCCGGTCGCAGACGGGCTCCCCGCGCGGCGAGCTG
CCGATCCGGACCAGCACGCAGAGCCCCGGGGCGCGCGACCGGCTGCACAAGCATTCGGGCAGCCTGGGCGGTACG
ATGACGCACTTCCCGTCGCAGCCGGCCTACTCGCGGCAGAACACGCCCGGCCCGCCCGGGGGGACCAACGGGCTG
CGGGTGGACTCGGCCTCGGCCAACTCGCGGACCGTGTCGCCGGCCCTGGGCACCGGCACGGTGGCGGCGCCGCCG
GCGGGCAACGAGATGGCGATGCCGACGCAGCTCAAGGTGCGCGTCAACTGCGACAGCGGCAACTACGTGACGCTG
GTGGTGGCCTTCAACATCACGTACCAGTCGCTCATCGATCGGATCGACGCCAAGCTGGCGCGCTTCATGAACAGC
AGCATCAGCAAGGGCATGCTGAAGCTGCGGTACCGCGACGAGGACGGCGACTTCGTGACGATCGAGAGCGACGAC
GACATCCAGATCGCCTTCATGGAGTGGCGCGAGGGGCTGCGGAACATGTACTCTGCCGGCGTGGGAGAGATAGAG
CTCTTCTGCGTGGGCGAGACGTCGTGA
Transcript >Hirsu2|7109
ATGGCCCATGCCCCGTTACTCAGAAACAACACCGCCCCGGTCTTCGAGCCCAGCCTGAGCGGCGCCCGAGGCCTG
CCACCGAACAGGATGAGCAATGCGCCGCGCACCAGCCAGTTGTCGGGCTCGACGGCCTACGCTGGCTCCTCGTCC
TCGTCGCTCAACTCCCTCACCAGCGGCGGCACCGTCGTGCCCGGCCCCAACGGCGGCCCCGTCATAGCCACCGCC
AACATCATCAACCAAAAGGCCGACGCCTCCCGCTCCCTCTACCAGATATGCATCTCCCTCAAGCAGCGCCTCGCC
CAGGTGCCCGGCTTCGAGCCCTTCCTCGACCAGCTCGACCCCACCGACCCCGTCGATCCGCTCTGGAACCTCTTC
CGCACCGGCTACCCCCTCCTGGCCATCTACAACTCGCTGCAGCCCGCCGAGCCGCTCAAGGTCGACGACGCCAAC
GCCAACGAGGCCAAGAAGTCCAAGATCGCCATCTTCAAGTTCGTCCAGGCCTGCATGAAGGAGCTCCGGGTGTCG
CCGACCGAGAGCTTCGTCATCACCGATCTGATGGGCAACGACACCAGCGGCTTCGTCAAGGTGACGCAAGTCGTC
AATTACGTGCTCGACCTCGCCGAGAACCGCGGTCTCCTGCTGCAAAGTCAACCGTACCCGGAAGACGAACTCGCG
AACCCCGCCGTCGCCTCGCAGATGAGCTACCGAGACCACATCGTCAAGGAGCTGGTCGACACGGAGCGCAAGTAC
GTGCAGGACCTGGAAAACCTCCACGACCTGAAAAAGGCCCTGGAGCAAAAGGGCGCCGTGCCCGGCGACATTGTC
CACCAGATCTTCCTCAACATCAACGCCATCCTCGACTTCCAGCGCCGGTTCCTCATCCGCGTCGAAACGACAAAC
TCGATGCCCAAGACGGTCCAGCGCTGGGGCGCGCCCTTCCGCTTCTACGAAGATGCCTTTGACATCTACCAGCCC
TTCATCGCCAACCAGCGCAAGGCGGCCCAGATCGCGAACCAGGTCTTCGACAAGATCCAGCTCTCCGACCACCCC
GTCGCCGCCGACTTCAACACCCTCGACGGCTTCCTGCTCAAGCCCATGCAGCGCCTGGTCAAGTACCCGCTGCTC
CTCAAGGACCTTCACAAGAAGACCGAAGATCCCGAGATCAAGGAGGACCTCATGCTGGGCTGCGAAGCCGCCGAG
CGGGTTCTGCACAAGGCCAACGAGGCCGTCAACCGAGACTTGCTGGACGAAGCCCTCGAGGAGCTGATCGGCAGA
GTGGACGACTGGAAGTCTCATAAGGTGGAGTCGTTCGGGAAGCTGCTCCTGCACGGCGTCTACGGCGTCATCACC
GGCAAAAGCGAGCAGGAGAAGGAGTACGAGATATACCTGTTCGAGTGCATCCTGCTCTGCTGCAAGGAGGCCTCC
ACCACCAAGAGCAAGGACAGAAGGGACAAGAGCCGGTCCTCGGGTCCCAAGCTTCGCAACCGCCACGCCAAGCTC
CAGCTAAAGGGCAGGATATTCATGACTAACGTGACTGACATCGTGTCTCTTTCCAAGCCCGGATCCCACAGCGTC
CAGATCTGGTGGAAAGGCGACCCCGGCGTCGAAAACTTCACCATCAAGTTCCTGCAAGAGGAGACGATGAAGAAG
TGGGCGGCCGGGCTCGAGACGCAGCGCAAGGACAACGTCCCGCGCCCATCGACGAGTCCGGACGGCCTCGCCACC
GACTTTTCGTGGACGCGGGACCAGGTCGGCGGGCTCGAGAACCCGTACCTGACACAGGATGACGAGGACGACGAA
GACTACGGCCCGCTGGCCGCCCCCGCGCAGTTCCCCATGTCCGTGCAGGGGATGCCGCGCCGGCCCTCGACGTCG
AACCTGAGGCAGCGGTCCGCCACGGGCGAGAGCTCCCAGTCGCTGGCCGGCATCGCCCGCGCGCCGCCGTCGCGG
TTCCCGATGCCGATGCCCCTGCCGGTCCCGACGCCGCTGAGCGTCCAGACGCAGAGCAACGGCGCGCTGTCGCCC
GGAACCAGGATCGGCGACAGCTACTTCTCCCCCGTCGCCGACTCGCCCGCCTCGTCGCGGACCAGCGCCGCGAGC
GGCATGTTCCCCGGCCCCCCCTACTCCTTCACCAAGTCGGGCACGCCGCAGCCGGGGTGGGACGACAGCAACCGG
TACACGGCGCCGGCCATGCCCCGGGCGCCGTCGCGCGACGGCAACTCGCCGAACCCGCACGGGCACCGGAACCCC
CGCGGGCCGTCGCTGCCCGCCATGGCGACGCAGAGCCAGAGCGCGGCCCAGCAGCAGAGGAGTCGGTCGTACAGC
ACGCCCGACGTCAACGCGACGGGGATCCCGCGGCAGCGGCAGCCCAGCCAGGGCCAGGTGCCGGCCGTGCCGGGC
ATCCCGCAACACCTCCACCCGGCGCACGACTCCAACATCCCCCGGTCGCAGACGGGCTCCCCGCGCGGCGAGCTG
CCGATCCGGACCAGCACGCAGAGCCCCGGGGCGCGCGACCGGCTGCACAAGCATTCGGGCAGCCTGGGCGGTACG
ATGACGCACTTCCCGTCGCAGCCGGCCTACTCGCGGCAGAACACGCCCGGCCCGCCCGGGGGGACCAACGGGCTG
CGGGTGGACTCGGCCTCGGCCAACTCGCGGACCGTGTCGCCGGCCCTGGGCACCGGCACGGTGGCGGCGCCGCCG
GCGGGCAACGAGATGGCGATGCCGACGCAGCTCAAGGTGCGCGTCAACTGCGACAGCGGCAACTACGTGACGCTG
GTGGTGGCCTTCAACATCACGTACCAGTCGCTCATCGATCGGATCGACGCCAAGCTGGCGCGCTTCATGAACAGC
AGCATCAGCAAGGGCATGCTGAAGCTGCGGTACCGCGACGAGGACGGCGACTTCGTGACGATCGAGAGCGACGAC
GACATCCAGATCGCCTTCATGGAGTGGCGCGAGGGGCTGCGGAACATGTACTCTGCCGGCGTGGGAGAGATAGAG
CTCTTCTGCGTGGGCGAGACGTCGTGA
Gene >Hirsu2|7109
ATGGCCCATGCCCCGTTACTCAGAAACAACACCGCCCCGGTCTTCGAGCCCAGCCTGAGCGGCGCCCGAGGCCTG
CCACCGAACAGGATGAGCAATGCGCCGCGCACCAGCCAGTTGTCGGGCTCGACGGCCTACGCTGGCTCCTCGTCC
TCGTCGCTCAACTCCCTCACCAGCGGCGGCACCGTCGTGCCCGGCCCCAACGGCGGCCCCGTCATAGCCACCGCC
AACATCATCAACCAAAAGGCCGACGCCTCCCGCTCCCTCTACCAGATATGCATCTCCCTCAAGCAGCGCCTCGCC
CAGGTGCCCGGCTTCGAGCCCTTCCTCGACCAGCTCGACCCCACCGACCCCGTCGATCCGCTCTGGAACCTCTTC
CGCACCGGCTACCCCCTCCTGGCCATCTACAACTCGCTGCAGCCCGCCGAGCCGCTCAAGGTCGACGACGCCAAC
GCCAACGAGGCCAAGAAGTCCAAGATCGCCATCTTCAAGTTCGTCCAGGCCTGCATGAAGGAGCTCCGGGTGTCG
CCGACCGAGAGCTTCGTCATCACCGATCTGATGGGCAACGACACCAGCGGCTTCGTCAAGGTATTCTTCTCTTCC
CCCCTGCCCTCCTCCTCTCCTCCGGAAACTGACGTCTTCCCCTTCGCCGCGCCCGATAGGTGACGCAAGTCGTCA
ATTACGTGCTCGACCTCGCCGAGAACCGCGGTCTCCTGCTGCAAAGTCAACCGTACCCGGAAGACGAACTCGCGA
ACCCCGCCGTCGCCTCGCAGATGAGCTACCGAGACCACATCGTCAAGGAGCTGGTCGACACGGAGCGCAAGTACG
TGCAGGACCTGGAAAACCTCCACGACCTGAAAAAGGCCCTGGAGCAAAAGGGCGCCGTGCCCGGCGACATTGTCC
ACCAGATCTTCCTCAACATCAACGCCATCCTCGACTTCCAGCGCCGGTTCCTCATCCGCGTCGAAACGACAAACT
CGATGCCCAAGACGGTCCAGCGCTGGGGCGCGCCCTTCCGCTTCTACGAAGATGCCTTTGACATCTACCAGCCCT
TCATCGCCAACCAGCGCAAGGCGGCCCAGATCGCGAACCAGGTCTTCGACAAGATCCAGCTCTCCGACCACCCCG
TCGCCGCCGACTTCAACACCCTCGACGGCTTCCTGCTCAAGCCCATGCAGCGCCTGGTCAAGTACCCGCTGCTCC
TCAAGGTAGGTTTCCGGACACTGTCCCTGACGTCGCAGACCGGGCCCGGCGGCTGACTCTCGTCTCGCGCAGGAC
CTTCACAAGAAGACCGAAGATCCCGAGATCAAGGAGGACCTCATGCTGGGCTGCGAAGCCGCCGAGCGGGTTCTG
CACAAGGCCAACGAGGCCGTCAACCGAGACTTGCTGGACGAAGCCCTCGAGGAGCTGATCGGCAGAGTGGACGAC
TGGAAGTCTCATAAGGTGGAGTCGTTCGGGAAGCTGCTCCTGCACGGCGTCTACGGCGTCATCACCGGCAAAAGC
GAGCAGGAGAAGGAGGTACGTCGGCCCCCCCCCCCCCCATCTGCCGCGACGGCACCCGTCCGTCGGACGGATGAG
GTGCTGACGAGACCTGCAGTACGAGATATACCTGTTCGAGTGCATCCTGCTCTGCTGCAAGGAGGCCTCCACCAC
CAAGAGCAAGGACAGAAGGGACAAGAGCCGGTCCTCGGGTCCCAAGCTTCGCAACCGCCACGCCAAGCTCCAGCT
AAAGGGCAGGATATTCATGACTAACGTGACTGACATCGTGTCTCTTTCCAAGCCCGGTAAGTCTTGGTCGGCCCG
CGATACCCCCCCTCTCTCTCCTCGTGGCCCTTGGGCACGCCCCTCTGACGCCGGCCGCCGAGCAGGATCCCACAG
CGTCCAGATCTGGTGGAAAGGCGACCCCGGCGTCGAAAACTTCACCATCAAGTTCCTGCAAGAGGAGACGATGAA
GAAGTGGGCGGCCGGGCTCGAGACGCAGCGCAAGGACAACGTCCCGCGCCCATCGACGAGTCCGGACGGCCTCGC
CACCGACTTTTCGTGGACGCGGGACCAGGTCGGCGGGCTCGAGAACCCGTACCTGACACAGGATGACGAGGACGA
CGAAGACTACGGCCCGCTGGCCGCCCCCGCGCAGTTCCCCATGTCCGTGCAGGGGATGCCGCGCCGGCCCTCGAC
GTCGAACCTGAGGCAGCGGTCCGCCACGGGCGAGAGCTCCCAGTCGCTGGCCGGCATCGCCCGCGCGCCGCCGTC
GCGGTTCCCGATGCCGATGCCCCTGCCGGTCCCGACGCCGCTGAGCGTCCAGACGCAGAGCAACGGCGCGCTGTC
GCCCGGAACCAGGATCGGCGACAGCTACTTCTCCCCCGTCGCCGACTCGCCCGCCTCGTCGCGGACCAGCGCCGC
GAGCGGCATGTTCCCCGGCCCCCCCTACTCCTTCACCAAGTCGGGCACGCCGCAGCCGGGGTGGGACGACAGCAA
CCGGTACACGGCGCCGGCCATGCCCCGGGCGCCGTCGCGCGACGGCAACTCGCCGAACCCGCACGGGCACCGGAA
CCCCCGCGGGCCGTCGCTGCCCGCCATGGCGACGCAGAGCCAGAGCGCGGCCCAGCAGCAGAGGAGTCGGTCGTA
CAGCACGCCCGACGTCAACGCGACGGGGATCCCGCGGCAGCGGCAGCCCAGCCAGGGCCAGGTGCCGGCCGTGCC
GGGCATCCCGCAACACCTCCACCCGGCGCACGACTCCAACATCCCCCGGTCGCAGACGGGCTCCCCGCGCGGCGA
GCTGCCGATCCGGACCAGCACGCAGAGCCCCGGGGCGCGCGACCGGCTGCACAAGCATTCGGGCAGCCTGGGCGG
TACGATGACGCACTTCCCGTCGCAGCCGGCCTACTCGCGGCAGAACACGCCCGGCCCGCCCGGGGGGACCAACGG
GCTGCGGGTGGACTCGGCCTCGGCCAACTCGCGGACCGTGTCGCCGGCCCTGGGCACCGGCACGGTGGCGGCGCC
GCCGGCGGGCAACGAGATGGCGATGCCGACGCAGCTCAAGGTGCGCGTCAACTGCGACAGCGGCAACTACGTGAC
GCTGGTGGTGGCCTTCAACATCACGTACCAGTCGCTCATCGATCGGATCGACGCCAAGCTGGCGCGCTTCATGAA
CAGCAGCATCAGCAAGGGCATGCTGAAGCTGCGGTACCGCGACGAGGACGGCGACTTCGTGACGATCGAGAGCGA
CGACGACATCCAGATCGCCTTCATGGAGTGGCGCGAGGGGCTGCGGAACATGTACTCTGCCGGCGTGGGAGAGAT
AGAGCTCTTCTGCGTGGGCGAGACGTCGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail