Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|7096
Gene name
LocationContig_397:7333..8962
Strand-
Gene length (bp)1629
Transcript length (bp)1158
Coding sequence length (bp)1158
Protein length (aa) 386

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00627 UBA UBA/TS-N domain 9.7E-10 148 182
PF00627 UBA UBA/TS-N domain 1.3E-13 338 373
PF09280 XPC-binding XPC-binding domain 9.6E-24 263 318
PF00240 ubiquitin Ubiquitin family 1.1E-20 4 73
PF11976 Rad60-SLD Ubiquitin-2 like Rad60 SUMO-like 9.4E-07 1 64

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O74803|RHP23_SCHPO UV excision repair protein rhp23 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rhp23 PE=1 SV=1 1 381 2.0E-94
sp|Q84L33|RD23B_ARATH Ubiquitin receptor RAD23b OS=Arabidopsis thaliana GN=RAD23B PE=1 SV=3 1 381 7.0E-70
sp|Q84L32|RD23A_ARATH Probable ubiquitin receptor RAD23a OS=Arabidopsis thaliana GN=RAD23A PE=1 SV=2 1 381 1.0E-65
sp|P54728|RD23B_MOUSE UV excision repair protein RAD23 homolog B OS=Mus musculus GN=Rad23b PE=1 SV=2 1 381 5.0E-65
sp|P54727|RD23B_HUMAN UV excision repair protein RAD23 homolog B OS=Homo sapiens GN=RAD23B PE=1 SV=1 1 381 8.0E-65
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O74803|RHP23_SCHPO UV excision repair protein rhp23 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rhp23 PE=1 SV=1 1 381 2.0E-94
sp|Q84L33|RD23B_ARATH Ubiquitin receptor RAD23b OS=Arabidopsis thaliana GN=RAD23B PE=1 SV=3 1 381 7.0E-70
sp|Q84L32|RD23A_ARATH Probable ubiquitin receptor RAD23a OS=Arabidopsis thaliana GN=RAD23A PE=1 SV=2 1 381 1.0E-65
sp|P54728|RD23B_MOUSE UV excision repair protein RAD23 homolog B OS=Mus musculus GN=Rad23b PE=1 SV=2 1 381 5.0E-65
sp|P54727|RD23B_HUMAN UV excision repair protein RAD23 homolog B OS=Homo sapiens GN=RAD23B PE=1 SV=1 1 381 8.0E-65
sp|Q29RK4|RD23B_BOVIN UV excision repair protein RAD23 homolog B OS=Bos taurus GN=RAD23B PE=2 SV=1 1 381 2.0E-62
sp|Q4KMA2|RD23B_RAT UV excision repair protein RAD23 homolog B OS=Rattus norvegicus GN=Rad23b PE=1 SV=1 1 381 2.0E-62
sp|P32628|RAD23_YEAST UV excision repair protein RAD23 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RAD23 PE=1 SV=1 1 379 3.0E-60
sp|Q84L30|RD23D_ARATH Ubiquitin receptor RAD23d OS=Arabidopsis thaliana GN=RAD23D PE=1 SV=2 1 381 1.0E-58
sp|A3KMV2|RD23A_BOVIN UV excision repair protein RAD23 homolog A OS=Bos taurus GN=RAD23A PE=2 SV=1 1 381 5.0E-58
sp|P54725|RD23A_HUMAN UV excision repair protein RAD23 homolog A OS=Homo sapiens GN=RAD23A PE=1 SV=1 1 381 8.0E-58
sp|P54726|RD23A_MOUSE UV excision repair protein RAD23 homolog A OS=Mus musculus GN=Rad23a PE=1 SV=2 1 381 4.0E-57
sp|Q84L31|RD23C_ARATH Ubiquitin receptor RAD23c OS=Arabidopsis thaliana GN=RAD23C PE=1 SV=2 1 381 2.0E-55
sp|Q40742|RAD23_ORYSJ Probable ubiquitin receptor RAD23 OS=Oryza sativa subsp. japonica GN=RAD23 PE=1 SV=2 1 383 3.0E-55
sp|Q54LV1|RAD23_DICDI UV excision repair protein RAD23 homolog OS=Dictyostelium discoideum GN=rcbA PE=1 SV=1 266 380 2.0E-18
sp|Q54LV1|RAD23_DICDI UV excision repair protein RAD23 homolog OS=Dictyostelium discoideum GN=rcbA PE=1 SV=1 1 76 4.0E-13
sp|Q10169|DSK2_SCHPO Deubiquitination-protection protein dph1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dph1 PE=3 SV=1 1 187 8.0E-09
sp|P18101|RL40_DROME Ubiquitin-60S ribosomal protein L40 OS=Drosophila melanogaster GN=RpL40 PE=1 SV=2 1 64 1.0E-08
sp|P49633|RL40_ACACA Ubiquitin-60S ribosomal protein L40 OS=Acanthamoeba castellanii PE=2 SV=2 1 64 2.0E-08
sp|P0C276|RL40_SHEEP Ubiquitin-60S ribosomal protein L40 OS=Ovis aries GN=UBA52 PE=2 SV=2 1 64 2.0E-08
sp|P62986|RL40_RAT Ubiquitin-60S ribosomal protein L40 OS=Rattus norvegicus GN=Uba52 PE=1 SV=2 1 64 2.0E-08
sp|P0C275|RL40_PONPY Ubiquitin-60S ribosomal protein L40 OS=Pongo pygmaeus GN=UBA52 PE=2 SV=2 1 64 2.0E-08
sp|P63053|RL40_PIG Ubiquitin-60S ribosomal protein L40 OS=Sus scrofa GN=UBA52 PE=1 SV=2 1 64 2.0E-08
sp|P68205|RL40_OPHHA Ubiquitin-60S ribosomal protein L40 OS=Ophiophagus hannah PE=2 SV=2 1 64 2.0E-08
sp|P62984|RL40_MOUSE Ubiquitin-60S ribosomal protein L40 OS=Mus musculus GN=Uba52 PE=1 SV=2 1 64 2.0E-08
sp|P0C273|RL40_MACFA Ubiquitin-60S ribosomal protein L40 OS=Macaca fascicularis GN=UBA52 PE=2 SV=2 1 64 2.0E-08
sp|P62987|RL40_HUMAN Ubiquitin-60S ribosomal protein L40 OS=Homo sapiens GN=UBA52 PE=1 SV=2 1 64 2.0E-08
sp|P63052|RL40_FELCA Ubiquitin-60S ribosomal protein L40 OS=Felis catus GN=UBA52 PE=2 SV=2 1 64 2.0E-08
sp|P63050|RL40_CANLF Ubiquitin-60S ribosomal protein L40 OS=Canis lupus familiaris GN=UBA52 PE=2 SV=2 1 64 2.0E-08
sp|P63048|RL40_BOVIN Ubiquitin-60S ribosomal protein L40 OS=Bos taurus GN=UBA52 PE=1 SV=2 1 64 2.0E-08
sp|Q8SWD4|UBIQ_ENCCU Ubiquitin OS=Encephalitozoon cuniculi (strain GB-M1) GN=ECU02_0740i PE=1 SV=1 1 64 2.0E-08
sp|P62975|UBIQ_RABIT Ubiquitin OS=Oryctolagus cuniculus PE=1 SV=1 1 64 3.0E-08
sp|P68197|UBIQ_CERCA Ubiquitin OS=Ceratitis capitata PE=1 SV=1 1 64 3.0E-08
sp|Q865C5|UBIQ_CAMDR Ubiquitin OS=Camelus dromedarius PE=3 SV=2 1 64 3.0E-08
sp|P48510|DSK2_YEAST Ubiquitin domain-containing protein DSK2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DSK2 PE=1 SV=2 10 75 6.0E-08
sp|O65381|RUB3_ARATH NEDD8-like protein RUB3 OS=Arabidopsis thaliana GN=RUB3 PE=2 SV=1 1 71 6.0E-08
sp|P69317|UBIQ_LUPPO Ubiquitin OS=Lupinus polyphyllus PE=3 SV=2 1 64 8.0E-08
sp|P69313|UBIQ_HELAN Ubiquitin OS=Helianthus annuus PE=3 SV=2 1 64 8.0E-08
sp|Q42202|RL40B_ARATH Ubiquitin-60S ribosomal protein L40-2 OS=Arabidopsis thaliana GN=RPL40B PE=1 SV=2 1 64 9.0E-08
sp|B9DHA6|RL40A_ARATH Ubiquitin-60S ribosomal protein L40-1 OS=Arabidopsis thaliana GN=RPL40A PE=1 SV=1 1 64 9.0E-08
sp|P14794|RL40_DICDI Ubiquitin-60S ribosomal protein L40 OS=Dictyostelium discoideum GN=ubqB PE=1 SV=2 1 64 1.0E-07
sp|P69310|UBIQ_AVESA Ubiquitin OS=Avena sativa PE=1 SV=1 1 64 1.0E-07
sp|P49636|RL40_NICSY Ubiquitin-60S ribosomal protein L40 OS=Nicotiana sylvestris GN=UBICEP52-7 PE=2 SV=2 1 64 1.0E-07
sp|Q4PLJ0|NEDD8_RABIT NEDD8 OS=Oryctolagus cuniculus GN=NEDD8 PE=3 SV=1 1 61 1.0E-07
sp|Q15843|NEDD8_HUMAN NEDD8 OS=Homo sapiens GN=NEDD8 PE=1 SV=1 1 61 1.0E-07
sp|P61282|NEDD8_BOVIN NEDD8 OS=Bos taurus GN=NEDD8 PE=3 SV=1 1 61 1.0E-07
sp|Q05120|UBIL_NPVOP Ubiquitin-like protein OS=Orgyia pseudotsugata multicapsid polyhedrosis virus GN=V-UBI PE=3 SV=1 1 64 1.0E-07
sp|P51423|RL40_BRARP Ubiquitin-60S ribosomal protein L40 OS=Brassica rapa subsp. pekinensis PE=2 SV=2 1 64 1.0E-07
sp|P69326|UBIQ_WHEAT Ubiquitin OS=Triticum aestivum PE=3 SV=2 1 64 1.0E-07
sp|P0C224|RL40_NEUCR Ubiquitin-60S ribosomal protein L40 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=crp-79 PE=1 SV=2 1 64 2.0E-07
sp|P0CH10|RL403_CHLRE Ubiquitin-60S ribosomal protein L40 OS=Chlamydomonas reinhardtii GN=UBI3 PE=1 SV=1 1 64 2.0E-07
sp|P0CH11|RL401_CHLRE Ubiquitin-60S ribosomal protein L40 OS=Chlamydomonas reinhardtii GN=UBI1 PE=1 SV=1 1 64 2.0E-07
sp|P68203|RS27A_SPOFR Ubiquitin-40S ribosomal protein S27a OS=Spodoptera frugiperda PE=2 SV=2 1 63 2.0E-07
sp|P19848|UBIQ_COPCO Ubiquitin OS=Coprinellus congregatus PE=1 SV=1 1 64 2.0E-07
sp|P69201|RL40_LEIMA Ubiquitin-60S ribosomal protein L40 OS=Leishmania major GN=UB-EP52 PE=3 SV=2 1 64 2.0E-07
sp|P15357|RS27A_DROME Ubiquitin-40S ribosomal protein S27a OS=Drosophila melanogaster GN=RpS27A PE=1 SV=2 1 63 2.0E-07
sp|P23398|UBIQP_STRPU Polyubiquitin (Fragment) OS=Strongylocentrotus purpuratus PE=2 SV=2 1 63 2.0E-07
sp|P68200|RS27A_ICTPU Ubiquitin-40S ribosomal protein S27a OS=Ictalurus punctatus GN=rps27a PE=2 SV=2 1 63 3.0E-07
sp|P62979|RS27A_HUMAN Ubiquitin-40S ribosomal protein S27a OS=Homo sapiens GN=RPS27A PE=1 SV=2 1 63 3.0E-07
sp|P62978|RS27A_CAVPO Ubiquitin-40S ribosomal protein S27a OS=Cavia porcellus GN=RPS27A PE=1 SV=2 1 63 3.0E-07
sp|P62992|RS27A_BOVIN Ubiquitin-40S ribosomal protein S27a OS=Bos taurus GN=RPS27A PE=1 SV=2 1 63 3.0E-07
sp|P62982|RS27A_RAT Ubiquitin-40S ribosomal protein S27a OS=Rattus norvegicus GN=Rps27a PE=1 SV=2 1 63 3.0E-07
sp|P62983|RS27A_MOUSE Ubiquitin-40S ribosomal protein S27a OS=Mus musculus GN=Rps27a PE=1 SV=2 1 63 3.0E-07
sp|P0CH09|RL402_YEAST Ubiquitin-60S ribosomal protein L40 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPL40B PE=1 SV=1 1 64 3.0E-07
sp|P0CH08|RL401_YEAST Ubiquitin-60S ribosomal protein L40 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPL40A PE=1 SV=1 1 64 3.0E-07
sp|P79781|RS27A_CHICK Ubiquitin-40S ribosomal protein S27a OS=Gallus gallus GN=RPS27A PE=2 SV=3 1 63 3.0E-07
sp|P14795|RL40_TRYCR Ubiquitin-60S ribosomal protein L40 OS=Trypanosoma cruzi GN=FUS1 PE=2 SV=2 1 64 3.0E-07
sp|P29504|RS27A_MANSE Ubiquitin-40S ribosomal protein S27a OS=Manduca sexta PE=2 SV=2 1 63 3.0E-07
sp|P68202|RS27A_PLUXY Ubiquitin-40S ribosomal protein S27a OS=Plutella xylostella PE=2 SV=2 1 63 3.0E-07
sp|Q71UE8|NEDD8_RAT NEDD8 OS=Rattus norvegicus GN=Nedd8 PE=1 SV=1 1 61 3.0E-07
sp|P29595|NEDD8_MOUSE NEDD8 OS=Mus musculus GN=Nedd8 PE=1 SV=2 1 61 3.0E-07
sp|P49632|RL40_CAEEL Ubiquitin-60S ribosomal protein L40 OS=Caenorhabditis elegans GN=ubq-2 PE=3 SV=2 1 64 4.0E-07
sp|P0CH07|RL402_SCHPO Ubiquitin-60S ribosomal protein L40 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=uep1 PE=1 SV=1 1 64 4.0E-07
sp|P0CH06|RL401_SCHPO Ubiquitin-60S ribosomal protein L40 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ubi1 PE=1 SV=1 1 64 4.0E-07
sp|P62972|UBIQP_XENLA Polyubiquitin (Fragment) OS=Xenopus laevis PE=1 SV=2 1 63 5.0E-07
sp|P62972|UBIQP_XENLA Polyubiquitin (Fragment) OS=Xenopus laevis PE=1 SV=2 1 63 5.0E-07
sp|P46575|RL40_EIMBO Ubiquitin-60S ribosomal protein L40 OS=Eimeria bovis PE=2 SV=2 1 63 5.0E-07
sp|Q9ARZ9|R27AA_ORYSJ Ubiquitin-40S ribosomal protein S27a-1 OS=Oryza sativa subsp. japonica GN=RPS27AA PE=2 SV=1 1 63 8.0E-07
sp|P0CG86|RS271_HORVU Ubiquitin-40S ribosomal protein S27a OS=Hordeum vulgare GN=MUB1 PE=3 SV=1 1 63 9.0E-07
sp|P62981|RS27A_SOLTU Ubiquitin-40S ribosomal protein S27a OS=Solanum tuberosum GN=UBI3 PE=2 SV=2 1 63 9.0E-07
sp|P62980|RS27A_SOLLC Ubiquitin-40S ribosomal protein S27a OS=Solanum lycopersicum GN=UBI3 PE=3 SV=2 1 63 9.0E-07
sp|P51431|R27AB_ORYSJ Ubiquitin-40S ribosomal protein S27a-2 OS=Oryza sativa subsp. japonica GN=RPS27AB PE=2 SV=3 1 63 9.0E-07
sp|P22589|UBIQP_PHYIN Polyubiquitin OS=Phytophthora infestans PE=1 SV=2 1 63 9.0E-07
sp|P22589|UBIQP_PHYIN Polyubiquitin OS=Phytophthora infestans PE=1 SV=2 1 63 9.0E-07
sp|P22589|UBIQP_PHYIN Polyubiquitin OS=Phytophthora infestans PE=1 SV=2 1 63 9.0E-07
sp|P59232|R27AB_ARATH Ubiquitin-40S ribosomal protein S27a-2 OS=Arabidopsis thaliana GN=RPS27AB PE=1 SV=2 1 63 1.0E-06
sp|P0CG87|RS272_HORVU Ubiquitin-40S ribosomal protein S27a OS=Hordeum vulgare GN=MUB2 PE=3 SV=1 1 63 1.0E-06
sp|P0CG60|UBB_PONPY Polyubiquitin-B OS=Pongo pygmaeus GN=UBB PE=3 SV=1 1 63 1.0E-06
sp|P0CG60|UBB_PONPY Polyubiquitin-B OS=Pongo pygmaeus GN=UBB PE=3 SV=1 1 63 1.0E-06
sp|P0CG60|UBB_PONPY Polyubiquitin-B OS=Pongo pygmaeus GN=UBB PE=3 SV=1 1 63 1.0E-06
sp|P0CG65|UBB_PANTR Polyubiquitin-B OS=Pan troglodytes GN=UBB PE=3 SV=1 1 63 1.0E-06
sp|P0CG65|UBB_PANTR Polyubiquitin-B OS=Pan troglodytes GN=UBB PE=3 SV=1 1 63 1.0E-06
sp|P0CG65|UBB_PANTR Polyubiquitin-B OS=Pan troglodytes GN=UBB PE=3 SV=1 1 63 1.0E-06
sp|P0CG47|UBB_HUMAN Polyubiquitin-B OS=Homo sapiens GN=UBB PE=1 SV=1 1 63 1.0E-06
sp|P0CG47|UBB_HUMAN Polyubiquitin-B OS=Homo sapiens GN=UBB PE=1 SV=1 1 63 1.0E-06
sp|P0CG47|UBB_HUMAN Polyubiquitin-B OS=Homo sapiens GN=UBB PE=1 SV=1 1 63 1.0E-06
sp|P0CG67|UBB_GORGO Polyubiquitin-B OS=Gorilla gorilla gorilla GN=UBB PE=3 SV=1 1 63 1.0E-06
sp|P0CG67|UBB_GORGO Polyubiquitin-B OS=Gorilla gorilla gorilla GN=UBB PE=3 SV=1 1 63 1.0E-06
sp|P0CG67|UBB_GORGO Polyubiquitin-B OS=Gorilla gorilla gorilla GN=UBB PE=3 SV=1 1 63 1.0E-06
sp|P59233|R27AC_ARATH Ubiquitin-40S ribosomal protein S27a-3 OS=Arabidopsis thaliana GN=RPS27AC PE=1 SV=2 1 63 1.0E-06
sp|P84589|UBIQ_LUMTE Ubiquitin (Fragment) OS=Lumbricus terrestris PE=1 SV=2 14 64 1.0E-06
sp|Q9VJ33|NEDD8_DROME NEDD8 OS=Drosophila melanogaster GN=Nedd8 PE=1 SV=1 1 62 1.0E-06
sp|P27923|RS27A_MAIZE Ubiquitin-40S ribosomal protein S27a OS=Zea mays GN=UBF9 PE=2 SV=2 1 63 1.0E-06
sp|P47905|RS27A_LUPAL Ubiquitin-40S ribosomal protein S27a OS=Lupinus albus PE=3 SV=2 1 63 1.0E-06
sp|P0CH35|RL40B_ORYSJ Ubiquitin-60S ribosomal protein L40-2 OS=Oryza sativa subsp. japonica GN=Ub-CEP52-2 PE=3 SV=1 1 63 1.0E-06
sp|P0CH34|RL40A_ORYSJ Ubiquitin-60S ribosomal protein L40-1 OS=Oryza sativa subsp. japonica GN=Ub-CEP52-1 PE=2 SV=1 1 63 1.0E-06
sp|P21899|RL40_TRYBB Ubiquitin-60S ribosomal protein L40 OS=Trypanosoma brucei brucei PE=1 SV=2 1 64 1.0E-06
sp|P59272|RS27A_DAUCA Ubiquitin-40S ribosomal protein S27a (Fragment) OS=Daucus carota PE=2 SV=2 1 63 1.0E-06
sp|P40909|RL40_CRYNJ Ubiquitin-60S ribosomal protein L40 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=UBI1 PE=1 SV=2 1 63 1.0E-06
sp|P59271|R27AA_ARATH Ubiquitin-40S ribosomal protein S27a-1 OS=Arabidopsis thaliana GN=RPS27AA PE=1 SV=2 1 63 2.0E-06
sp|P0CG55|UBB_SHEEP Polyubiquitin-B OS=Ovis aries GN=UBB PE=2 SV=1 1 63 2.0E-06
sp|P0CG55|UBB_SHEEP Polyubiquitin-B OS=Ovis aries GN=UBB PE=2 SV=1 1 63 2.0E-06
sp|P0CG55|UBB_SHEEP Polyubiquitin-B OS=Ovis aries GN=UBB PE=2 SV=1 1 63 2.0E-06
sp|P0CG55|UBB_SHEEP Polyubiquitin-B OS=Ovis aries GN=UBB PE=2 SV=1 1 63 2.0E-06
sp|P14799|RS27A_NEUCR Ubiquitin-40S ribosomal protein S27a OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=ubi::crp-6 PE=1 SV=4 1 63 2.0E-06
sp|P0CG53|UBB_BOVIN Polyubiquitin-B OS=Bos taurus GN=UBB PE=1 SV=1 1 63 2.0E-06
sp|P0CG53|UBB_BOVIN Polyubiquitin-B OS=Bos taurus GN=UBB PE=1 SV=1 1 63 2.0E-06
sp|P0CG53|UBB_BOVIN Polyubiquitin-B OS=Bos taurus GN=UBB PE=1 SV=1 1 63 2.0E-06
sp|P0CG53|UBB_BOVIN Polyubiquitin-B OS=Bos taurus GN=UBB PE=1 SV=1 1 63 2.0E-06
sp|Q8MKD1|UBB_HORSE Polyubiquitin-B OS=Equus caballus GN=UBB PE=2 SV=3 1 63 2.0E-06
sp|Q8MKD1|UBB_HORSE Polyubiquitin-B OS=Equus caballus GN=UBB PE=2 SV=3 1 63 2.0E-06
sp|Q8MKD1|UBB_HORSE Polyubiquitin-B OS=Equus caballus GN=UBB PE=2 SV=3 1 63 2.0E-06
sp|P0CG54|UBB_CAVPO Polyubiquitin-B OS=Cavia porcellus GN=UBB PE=2 SV=1 1 63 2.0E-06
sp|P0CG54|UBB_CAVPO Polyubiquitin-B OS=Cavia porcellus GN=UBB PE=2 SV=1 1 63 2.0E-06
sp|P0CG54|UBB_CAVPO Polyubiquitin-B OS=Cavia porcellus GN=UBB PE=2 SV=1 1 63 2.0E-06
sp|P0CG54|UBB_CAVPO Polyubiquitin-B OS=Cavia porcellus GN=UBB PE=2 SV=1 1 63 2.0E-06
sp|P0CG51|UBB_RAT Polyubiquitin-B OS=Rattus norvegicus GN=Ubb PE=1 SV=1 1 63 2.0E-06
sp|P0CG51|UBB_RAT Polyubiquitin-B OS=Rattus norvegicus GN=Ubb PE=1 SV=1 1 63 2.0E-06
sp|P0CG51|UBB_RAT Polyubiquitin-B OS=Rattus norvegicus GN=Ubb PE=1 SV=1 1 63 2.0E-06
sp|P0CG51|UBB_RAT Polyubiquitin-B OS=Rattus norvegicus GN=Ubb PE=1 SV=1 1 63 2.0E-06
sp|P0CG49|UBB_MOUSE Polyubiquitin-B OS=Mus musculus GN=Ubb PE=2 SV=1 1 63 2.0E-06
sp|P0CG49|UBB_MOUSE Polyubiquitin-B OS=Mus musculus GN=Ubb PE=2 SV=1 1 63 2.0E-06
sp|P0CG49|UBB_MOUSE Polyubiquitin-B OS=Mus musculus GN=Ubb PE=2 SV=1 1 63 2.0E-06
sp|P0CG49|UBB_MOUSE Polyubiquitin-B OS=Mus musculus GN=Ubb PE=2 SV=1 1 63 2.0E-06
sp|P0CG62|UBB_CHICK Polyubiquitin-B OS=Gallus gallus GN=UBB PE=2 SV=1 1 63 2.0E-06
sp|P0CG62|UBB_CHICK Polyubiquitin-B OS=Gallus gallus GN=UBB PE=2 SV=1 1 63 2.0E-06
sp|P0CG62|UBB_CHICK Polyubiquitin-B OS=Gallus gallus GN=UBB PE=2 SV=1 1 63 2.0E-06
sp|P0CG62|UBB_CHICK Polyubiquitin-B OS=Gallus gallus GN=UBB PE=2 SV=1 1 63 2.0E-06
sp|P05759|RS27A_YEAST Ubiquitin-40S ribosomal protein S31 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPS31 PE=1 SV=3 1 63 3.0E-06
sp|P0C031|RUB2_ORYSJ Ubiquitin-NEDD8-like protein RUB2 OS=Oryza sativa subsp. japonica GN=RUB2 PE=2 SV=2 1 63 3.0E-06
sp|P0C032|RUB3_ORYSJ Ubiquitin-like protein-NEDD8-like protein RUB3 OS=Oryza sativa subsp. japonica GN=RUB3 PE=3 SV=2 1 63 3.0E-06
sp|Q8RUC6|RUB2_ARATH Ubiquitin-NEDD8-like protein RUB2 OS=Arabidopsis thaliana GN=RUB2 PE=1 SV=3 1 63 3.0E-06
sp|P0CG83|UBIQP_HORVU Polyubiquitin (Fragment) OS=Hordeum vulgare PE=2 SV=1 1 63 3.0E-06
sp|P0CG83|UBIQP_HORVU Polyubiquitin (Fragment) OS=Hordeum vulgare PE=2 SV=1 1 63 3.0E-06
sp|Q9SHE7|RUB1_ARATH Ubiquitin-NEDD8-like protein RUB1 OS=Arabidopsis thaliana GN=RUB1 PE=1 SV=3 1 63 3.0E-06
sp|P0CG68|UBC_PIG Polyubiquitin-C OS=Sus scrofa GN=UBC PE=2 SV=1 1 63 3.0E-06
sp|P0CG68|UBC_PIG Polyubiquitin-C OS=Sus scrofa GN=UBC PE=2 SV=1 1 63 3.0E-06
sp|P0CG68|UBC_PIG Polyubiquitin-C OS=Sus scrofa GN=UBC PE=2 SV=1 1 63 3.0E-06
sp|P0CG68|UBC_PIG Polyubiquitin-C OS=Sus scrofa GN=UBC PE=2 SV=1 1 63 3.0E-06
sp|P0CG68|UBC_PIG Polyubiquitin-C OS=Sus scrofa GN=UBC PE=2 SV=1 1 63 3.0E-06
sp|P0CG68|UBC_PIG Polyubiquitin-C OS=Sus scrofa GN=UBC PE=2 SV=1 1 63 3.0E-06
sp|P0CG66|UBC_GORGO Polyubiquitin-C OS=Gorilla gorilla gorilla GN=UBC PE=3 SV=1 1 63 3.0E-06
sp|P0CG66|UBC_GORGO Polyubiquitin-C OS=Gorilla gorilla gorilla GN=UBC PE=3 SV=1 1 63 3.0E-06
sp|P0CG66|UBC_GORGO Polyubiquitin-C OS=Gorilla gorilla gorilla GN=UBC PE=3 SV=1 1 63 3.0E-06
sp|P0CG66|UBC_GORGO Polyubiquitin-C OS=Gorilla gorilla gorilla GN=UBC PE=3 SV=1 1 63 3.0E-06
sp|P0CG66|UBC_GORGO Polyubiquitin-C OS=Gorilla gorilla gorilla GN=UBC PE=3 SV=1 1 63 3.0E-06
sp|P0CG66|UBC_GORGO Polyubiquitin-C OS=Gorilla gorilla gorilla GN=UBC PE=3 SV=1 1 63 3.0E-06
sp|P0CG66|UBC_GORGO Polyubiquitin-C OS=Gorilla gorilla gorilla GN=UBC PE=3 SV=1 1 63 3.0E-06
sp|P0CG66|UBC_GORGO Polyubiquitin-C OS=Gorilla gorilla gorilla GN=UBC PE=3 SV=1 1 63 3.0E-06
sp|P69200|RL40_LEITA Ubiquitin-60S ribosomal protein L40 OS=Leishmania tarentolae GN=UB-EP52 PE=3 SV=2 1 64 3.0E-06
sp|P0C073|RUB1_DESAN Ubiquitin-NEDD8-like protein RUB1 OS=Deschampsia antarctica GN=RUB1 PE=2 SV=2 1 63 3.0E-06
sp|P0C8R3|RS27B_SCHPO Ubiquitin-40S ribosomal protein S27b OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ubi5 PE=1 SV=2 1 63 3.0E-06
sp|P62976|UBIQP_CRIGR Polyubiquitin OS=Cricetulus griseus PE=2 SV=2 1 63 3.0E-06
sp|P0CG69|UBIQP_DROME Polyubiquitin OS=Drosophila melanogaster GN=Ubi-p63E PE=3 SV=1 1 63 3.0E-06
sp|P0CG69|UBIQP_DROME Polyubiquitin OS=Drosophila melanogaster GN=Ubi-p63E PE=3 SV=1 1 63 3.0E-06
sp|P0CG69|UBIQP_DROME Polyubiquitin OS=Drosophila melanogaster GN=Ubi-p63E PE=3 SV=1 1 63 3.0E-06
sp|P0CG69|UBIQP_DROME Polyubiquitin OS=Drosophila melanogaster GN=Ubi-p63E PE=3 SV=1 1 63 3.0E-06
sp|P0CG69|UBIQP_DROME Polyubiquitin OS=Drosophila melanogaster GN=Ubi-p63E PE=3 SV=1 1 63 3.0E-06
sp|P0CG69|UBIQP_DROME Polyubiquitin OS=Drosophila melanogaster GN=Ubi-p63E PE=3 SV=1 1 63 3.0E-06
sp|P0CG69|UBIQP_DROME Polyubiquitin OS=Drosophila melanogaster GN=Ubi-p63E PE=3 SV=1 1 63 3.0E-06
sp|P0CG69|UBIQP_DROME Polyubiquitin OS=Drosophila melanogaster GN=Ubi-p63E PE=3 SV=1 1 63 3.0E-06
sp|P0CG69|UBIQP_DROME Polyubiquitin OS=Drosophila melanogaster GN=Ubi-p63E PE=3 SV=1 1 63 3.0E-06
sp|P0CG69|UBIQP_DROME Polyubiquitin OS=Drosophila melanogaster GN=Ubi-p63E PE=3 SV=1 1 63 3.0E-06
sp|P0CG48|UBC_HUMAN Polyubiquitin-C OS=Homo sapiens GN=UBC PE=1 SV=3 1 63 3.0E-06
sp|P0CG48|UBC_HUMAN Polyubiquitin-C OS=Homo sapiens GN=UBC PE=1 SV=3 1 63 3.0E-06
sp|P0CG48|UBC_HUMAN Polyubiquitin-C OS=Homo sapiens GN=UBC PE=1 SV=3 1 63 3.0E-06
sp|P0CG48|UBC_HUMAN Polyubiquitin-C OS=Homo sapiens GN=UBC PE=1 SV=3 1 63 3.0E-06
sp|P0CG48|UBC_HUMAN Polyubiquitin-C OS=Homo sapiens GN=UBC PE=1 SV=3 1 63 3.0E-06
sp|P0CG48|UBC_HUMAN Polyubiquitin-C OS=Homo sapiens GN=UBC PE=1 SV=3 1 63 3.0E-06
sp|P0CG48|UBC_HUMAN Polyubiquitin-C OS=Homo sapiens GN=UBC PE=1 SV=3 1 63 3.0E-06
sp|P0CG48|UBC_HUMAN Polyubiquitin-C OS=Homo sapiens GN=UBC PE=1 SV=3 1 63 3.0E-06
sp|P0CG48|UBC_HUMAN Polyubiquitin-C OS=Homo sapiens GN=UBC PE=1 SV=3 1 63 3.0E-06
sp|P0C030|RUB1_ORYSJ Ubiquitin-NEDD8-like protein RUB1 OS=Oryza sativa subsp. japonica GN=RUB1 PE=2 SV=2 1 63 3.0E-06
sp|P0C016|RS27A_SCHPO Ubiquitin-40S ribosomal protein S27a OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ubi3 PE=1 SV=2 1 63 3.0E-06
sp|P62976|UBIQP_CRIGR Polyubiquitin OS=Cricetulus griseus PE=2 SV=2 1 63 4.0E-06
sp|P62976|UBIQP_CRIGR Polyubiquitin OS=Cricetulus griseus PE=2 SV=2 1 63 4.0E-06
sp|P62976|UBIQP_CRIGR Polyubiquitin OS=Cricetulus griseus PE=2 SV=2 1 63 4.0E-06
sp|P62976|UBIQP_CRIGR Polyubiquitin OS=Cricetulus griseus PE=2 SV=2 1 63 4.0E-06
sp|P62976|UBIQP_CRIGR Polyubiquitin OS=Cricetulus griseus PE=2 SV=2 1 63 4.0E-06
sp|P62976|UBIQP_CRIGR Polyubiquitin OS=Cricetulus griseus PE=2 SV=2 1 63 4.0E-06
sp|P62976|UBIQP_CRIGR Polyubiquitin OS=Cricetulus griseus PE=2 SV=2 1 63 4.0E-06
sp|P0CH28|UBC_BOVIN Polyubiquitin-C OS=Bos taurus GN=UBC PE=1 SV=1 1 63 4.0E-06
sp|P0CH28|UBC_BOVIN Polyubiquitin-C OS=Bos taurus GN=UBC PE=1 SV=1 1 63 4.0E-06
sp|P0CH28|UBC_BOVIN Polyubiquitin-C OS=Bos taurus GN=UBC PE=1 SV=1 1 63 4.0E-06
sp|P0CH28|UBC_BOVIN Polyubiquitin-C OS=Bos taurus GN=UBC PE=1 SV=1 1 63 4.0E-06
sp|P0CH28|UBC_BOVIN Polyubiquitin-C OS=Bos taurus GN=UBC PE=1 SV=1 1 63 4.0E-06
sp|P0CH28|UBC_BOVIN Polyubiquitin-C OS=Bos taurus GN=UBC PE=1 SV=1 1 63 4.0E-06
sp|P0CH28|UBC_BOVIN Polyubiquitin-C OS=Bos taurus GN=UBC PE=1 SV=1 1 63 4.0E-06
sp|P0CH28|UBC_BOVIN Polyubiquitin-C OS=Bos taurus GN=UBC PE=1 SV=1 1 63 4.0E-06
sp|P0CG61|UBC_PONPY Polyubiquitin-C OS=Pongo pygmaeus GN=UBC PE=3 SV=1 1 63 4.0E-06
sp|P0CG61|UBC_PONPY Polyubiquitin-C OS=Pongo pygmaeus GN=UBC PE=3 SV=1 1 63 4.0E-06
sp|P0CG61|UBC_PONPY Polyubiquitin-C OS=Pongo pygmaeus GN=UBC PE=3 SV=1 1 63 4.0E-06
sp|P0CG61|UBC_PONPY Polyubiquitin-C OS=Pongo pygmaeus GN=UBC PE=3 SV=1 1 63 4.0E-06
sp|P0CG61|UBC_PONPY Polyubiquitin-C OS=Pongo pygmaeus GN=UBC PE=3 SV=1 1 63 4.0E-06
sp|P0CG61|UBC_PONPY Polyubiquitin-C OS=Pongo pygmaeus GN=UBC PE=3 SV=1 1 63 4.0E-06
sp|P0CG61|UBC_PONPY Polyubiquitin-C OS=Pongo pygmaeus GN=UBC PE=3 SV=1 1 63 4.0E-06
sp|P0CG61|UBC_PONPY Polyubiquitin-C OS=Pongo pygmaeus GN=UBC PE=3 SV=1 1 63 4.0E-06
sp|P0CG61|UBC_PONPY Polyubiquitin-C OS=Pongo pygmaeus GN=UBC PE=3 SV=1 1 63 4.0E-06
sp|P0CG61|UBC_PONPY Polyubiquitin-C OS=Pongo pygmaeus GN=UBC PE=3 SV=1 1 63 4.0E-06
sp|P0CG64|UBC_PANTR Polyubiquitin-C OS=Pan troglodytes GN=UBC PE=3 SV=1 1 63 4.0E-06
sp|P0CG64|UBC_PANTR Polyubiquitin-C OS=Pan troglodytes GN=UBC PE=3 SV=1 1 63 4.0E-06
sp|P0CG64|UBC_PANTR Polyubiquitin-C OS=Pan troglodytes GN=UBC PE=3 SV=1 1 63 4.0E-06
sp|P0CG64|UBC_PANTR Polyubiquitin-C OS=Pan troglodytes GN=UBC PE=3 SV=1 1 63 4.0E-06
sp|P0CG64|UBC_PANTR Polyubiquitin-C OS=Pan troglodytes GN=UBC PE=3 SV=1 1 63 4.0E-06
sp|P0CG64|UBC_PANTR Polyubiquitin-C OS=Pan troglodytes GN=UBC PE=3 SV=1 1 63 4.0E-06
sp|P0CG64|UBC_PANTR Polyubiquitin-C OS=Pan troglodytes GN=UBC PE=3 SV=1 1 63 4.0E-06
sp|P0CG64|UBC_PANTR Polyubiquitin-C OS=Pan troglodytes GN=UBC PE=3 SV=1 1 63 4.0E-06
sp|P0CG64|UBC_PANTR Polyubiquitin-C OS=Pan troglodytes GN=UBC PE=3 SV=1 1 63 4.0E-06
sp|P0CG64|UBC_PANTR Polyubiquitin-C OS=Pan troglodytes GN=UBC PE=3 SV=1 1 63 4.0E-06
sp|Q63429|UBC_RAT Polyubiquitin-C OS=Rattus norvegicus GN=Ubc PE=1 SV=1 1 63 4.0E-06
sp|Q63429|UBC_RAT Polyubiquitin-C OS=Rattus norvegicus GN=Ubc PE=1 SV=1 1 63 4.0E-06
sp|Q63429|UBC_RAT Polyubiquitin-C OS=Rattus norvegicus GN=Ubc PE=1 SV=1 1 63 4.0E-06
sp|Q63429|UBC_RAT Polyubiquitin-C OS=Rattus norvegicus GN=Ubc PE=1 SV=1 1 63 4.0E-06
sp|Q63429|UBC_RAT Polyubiquitin-C OS=Rattus norvegicus GN=Ubc PE=1 SV=1 1 63 4.0E-06
sp|Q63429|UBC_RAT Polyubiquitin-C OS=Rattus norvegicus GN=Ubc PE=1 SV=1 1 63 4.0E-06
sp|Q63429|UBC_RAT Polyubiquitin-C OS=Rattus norvegicus GN=Ubc PE=1 SV=1 1 63 4.0E-06
sp|Q63429|UBC_RAT Polyubiquitin-C OS=Rattus norvegicus GN=Ubc PE=1 SV=1 1 63 4.0E-06
sp|Q63429|UBC_RAT Polyubiquitin-C OS=Rattus norvegicus GN=Ubc PE=1 SV=1 1 63 4.0E-06
sp|Q63429|UBC_RAT Polyubiquitin-C OS=Rattus norvegicus GN=Ubc PE=1 SV=1 1 63 4.0E-06
sp|P0CG50|UBC_MOUSE Polyubiquitin-C OS=Mus musculus GN=Ubc PE=1 SV=2 1 63 4.0E-06
sp|P0CG50|UBC_MOUSE Polyubiquitin-C OS=Mus musculus GN=Ubc PE=1 SV=2 1 63 4.0E-06
sp|P0CG50|UBC_MOUSE Polyubiquitin-C OS=Mus musculus GN=Ubc PE=1 SV=2 1 63 4.0E-06
sp|P0CG50|UBC_MOUSE Polyubiquitin-C OS=Mus musculus GN=Ubc PE=1 SV=2 1 63 4.0E-06
sp|P0CG50|UBC_MOUSE Polyubiquitin-C OS=Mus musculus GN=Ubc PE=1 SV=2 1 63 4.0E-06
sp|P0CG50|UBC_MOUSE Polyubiquitin-C OS=Mus musculus GN=Ubc PE=1 SV=2 1 63 4.0E-06
sp|P0CG50|UBC_MOUSE Polyubiquitin-C OS=Mus musculus GN=Ubc PE=1 SV=2 1 63 4.0E-06
sp|P0CG50|UBC_MOUSE Polyubiquitin-C OS=Mus musculus GN=Ubc PE=1 SV=2 1 63 4.0E-06
sp|P0CG50|UBC_MOUSE Polyubiquitin-C OS=Mus musculus GN=Ubc PE=1 SV=2 1 63 4.0E-06
sp|P69061|RS27A_KLULA Ubiquitin-40S ribosomal protein S27a OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=ubi3 PE=1 SV=2 1 63 4.0E-06
sp|P0CG68|UBC_PIG Polyubiquitin-C OS=Sus scrofa GN=UBC PE=2 SV=1 1 63 5.0E-06
sp|P0DJ25|RL40_TETTS Ubiquitin-60S ribosomal protein L40 OS=Tetrahymena thermophila (strain SB210) GN=RPL40 PE=1 SV=1 1 63 5.0E-06
sp|P33190|RL40_TETPY Ubiquitin-60S ribosomal protein L40 OS=Tetrahymena pyriformis GN=TUF11 PE=3 SV=2 1 63 5.0E-06
sp|P0C031|RUB2_ORYSJ Ubiquitin-NEDD8-like protein RUB2 OS=Oryza sativa subsp. japonica GN=RUB2 PE=2 SV=2 3 71 6.0E-06
sp|P0C073|RUB1_DESAN Ubiquitin-NEDD8-like protein RUB1 OS=Deschampsia antarctica GN=RUB1 PE=2 SV=2 3 71 6.0E-06
sp|P0CH28|UBC_BOVIN Polyubiquitin-C OS=Bos taurus GN=UBC PE=1 SV=1 1 63 6.0E-06
sp|P0CH33|UBQ11_ARATH Polyubiquitin 11 OS=Arabidopsis thaliana GN=UBQ11 PE=1 SV=1 1 63 6.0E-06
sp|P0CH33|UBQ11_ARATH Polyubiquitin 11 OS=Arabidopsis thaliana GN=UBQ11 PE=1 SV=1 1 63 6.0E-06
sp|P0CH33|UBQ11_ARATH Polyubiquitin 11 OS=Arabidopsis thaliana GN=UBQ11 PE=1 SV=1 1 63 6.0E-06
sp|P69315|UBIQP_LINUS Polyubiquitin (Fragment) OS=Linum usitatissimum PE=3 SV=2 1 63 6.0E-06
sp|Q8MKD1|UBB_HORSE Polyubiquitin-B OS=Equus caballus GN=UBB PE=2 SV=3 1 63 7.0E-06
sp|Q8R317|UBQL1_MOUSE Ubiquilin-1 OS=Mus musculus GN=Ubqln1 PE=1 SV=1 1 116 7.0E-06
sp|P0C030|RUB1_ORYSJ Ubiquitin-NEDD8-like protein RUB1 OS=Oryza sativa subsp. japonica GN=RUB1 PE=2 SV=2 3 71 8.0E-06
sp|P14797|RS27A_DICDI Ubiquitin-40S ribosomal protein S27a OS=Dictyostelium discoideum GN=ubqC PE=1 SV=2 1 63 8.0E-06
sp|Q9YHD3|BAG6A_XENLA Large proline-rich protein bag6-A OS=Xenopus laevis GN=Bag6-a PE=2 SV=1 1 73 8.0E-06
sp|Q9SHE7|RUB1_ARATH Ubiquitin-NEDD8-like protein RUB1 OS=Arabidopsis thaliana GN=RUB1 PE=1 SV=3 3 71 9.0E-06
sp|P69315|UBIQP_LINUS Polyubiquitin (Fragment) OS=Linum usitatissimum PE=3 SV=2 1 63 9.0E-06
sp|P69315|UBIQP_LINUS Polyubiquitin (Fragment) OS=Linum usitatissimum PE=3 SV=2 1 63 9.0E-06
sp|Q1EC66|UBQ3_ARATH Polyubiquitin 3 OS=Arabidopsis thaliana GN=UBQ3 PE=1 SV=1 1 63 9.0E-06
sp|Q1EC66|UBQ3_ARATH Polyubiquitin 3 OS=Arabidopsis thaliana GN=UBQ3 PE=1 SV=1 1 63 9.0E-06
sp|Q1EC66|UBQ3_ARATH Polyubiquitin 3 OS=Arabidopsis thaliana GN=UBQ3 PE=1 SV=1 1 63 9.0E-06
sp|Q1EC66|UBQ3_ARATH Polyubiquitin 3 OS=Arabidopsis thaliana GN=UBQ3 PE=1 SV=1 1 63 9.0E-06
sp|Q3E7T8|UBQ14_ARATH Polyubiquitin 14 OS=Arabidopsis thaliana GN=UBQ14 PE=1 SV=2 1 63 9.0E-06
sp|Q3E7T8|UBQ14_ARATH Polyubiquitin 14 OS=Arabidopsis thaliana GN=UBQ14 PE=1 SV=2 1 63 9.0E-06
sp|Q3E7T8|UBQ14_ARATH Polyubiquitin 14 OS=Arabidopsis thaliana GN=UBQ14 PE=1 SV=2 1 63 9.0E-06
sp|Q3E7T8|UBQ14_ARATH Polyubiquitin 14 OS=Arabidopsis thaliana GN=UBQ14 PE=1 SV=2 1 63 9.0E-06
sp|P69325|UBIQP_SOYBN Polyubiquitin OS=Glycine max GN=SUBI-1 PE=2 SV=2 1 63 9.0E-06
sp|P69325|UBIQP_SOYBN Polyubiquitin OS=Glycine max GN=SUBI-1 PE=2 SV=2 1 63 9.0E-06
sp|P69325|UBIQP_SOYBN Polyubiquitin OS=Glycine max GN=SUBI-1 PE=2 SV=2 1 63 9.0E-06
sp|P69325|UBIQP_SOYBN Polyubiquitin OS=Glycine max GN=SUBI-1 PE=2 SV=2 1 63 9.0E-06
sp|Q93725|NEDD8_CAEEL NEDD8 OS=Caenorhabditis elegans GN=ned-8 PE=1 SV=1 1 61 9.0E-06
sp|P0CG73|UBI1P_CANAX Polyubiquitin OS=Candida albicans GN=UBI1 PE=1 SV=1 1 63 9.0E-06
sp|P0CG73|UBI1P_CANAX Polyubiquitin OS=Candida albicans GN=UBI1 PE=1 SV=1 1 63 9.0E-06
sp|P0CG73|UBI1P_CANAX Polyubiquitin OS=Candida albicans GN=UBI1 PE=1 SV=1 1 63 9.0E-06
sp|P69309|UBIQP_AVEFA Polyubiquitin OS=Avena fatua PE=2 SV=2 1 63 9.0E-06
sp|P69309|UBIQP_AVEFA Polyubiquitin OS=Avena fatua PE=2 SV=2 1 63 9.0E-06
sp|P69309|UBIQP_AVEFA Polyubiquitin OS=Avena fatua PE=2 SV=2 1 63 9.0E-06
sp|P69309|UBIQP_AVEFA Polyubiquitin OS=Avena fatua PE=2 SV=2 1 63 9.0E-06
sp|P0CG70|UBI4P_NEUCR Polyubiquitin OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=ubi PE=1 SV=1 1 63 9.0E-06
sp|P0CG70|UBI4P_NEUCR Polyubiquitin OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=ubi PE=1 SV=1 1 63 9.0E-06
sp|P0CG70|UBI4P_NEUCR Polyubiquitin OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=ubi PE=1 SV=1 1 63 9.0E-06
sp|P0CG70|UBI4P_NEUCR Polyubiquitin OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=ubi PE=1 SV=1 1 63 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0006289 nucleotide-excision repair Yes
GO:0005515 protein binding Yes
GO:0003684 damaged DNA binding Yes
GO:0043161 proteasome-mediated ubiquitin-dependent protein catabolic process Yes
GO:0044248 cellular catabolic process No
GO:0003676 nucleic acid binding No
GO:0006281 DNA repair No
GO:0071704 organic substance metabolic process No
GO:0051603 proteolysis involved in cellular protein catabolic process No
GO:1901565 organonitrogen compound catabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0044238 primary metabolic process No
GO:0005488 binding No
GO:0050896 response to stimulus No
GO:0008152 metabolic process No
GO:0006508 proteolysis No
GO:0008150 biological_process No
GO:0019941 modification-dependent protein catabolic process No
GO:0044260 cellular macromolecule metabolic process No
GO:1901575 organic substance catabolic process No
GO:0046483 heterocycle metabolic process No
GO:0044265 cellular macromolecule catabolic process No
GO:0003674 molecular_function No
GO:0003677 DNA binding No
GO:0030163 protein catabolic process No
GO:0006139 nucleobase-containing compound metabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:1901363 heterocyclic compound binding No
GO:0009057 macromolecule catabolic process No
GO:0009056 catabolic process No
GO:0051716 cellular response to stimulus No
GO:0043632 modification-dependent macromolecule catabolic process No
GO:0090304 nucleic acid metabolic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0019538 protein metabolic process No
GO:0006974 cellular response to DNA damage stimulus No
GO:0006259 DNA metabolic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0033554 cellular response to stress No
GO:0006511 ubiquitin-dependent protein catabolic process No
GO:0010498 proteasomal protein catabolic process No
GO:0044237 cellular metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0097159 organic cyclic compound binding No
GO:0006950 response to stress No
GO:0009987 cellular process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 49 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|7096
MKVTFRDLKQQKFTLEVEPTDQILAVKEKISGEKGWDPKYQKLIYSGKILKDEETVASYNIEEKGFVVCMVNKPK
EKPAASSSAAEPSAAPPATPAQPVASTPAPPAAPSQSSSAHAAAPATPTPPRATEAQPSGGNASGLAMGDERTEA
IANMEAMGFERPHIEAAMRAAFNNPDRAVEYLLNGIPDNVQQEQQQRRAPAAASTGASAQSAPPAQSGEDDGGVN
LFDLAAQQGGGAAPRGSGMGSAAAAAAAAAQGGDLGNLDFLRHNAQFQQLRQVVQQQPQMLEPILQQLGAGNPQL
AQLIASNPDQFLQLLGENADDDVPLPPGAQAISVTEEERDAIERLCRLGFDRDQAIQAYFACDKNEELAANFLFE
QPEDEEPPTN*
Coding >Hirsu2|7096
ATGAAGGTCACATTTAGGGACTTGAAGCAGCAAAAGTTCACCCTCGAGGTTGAACCGACCGACCAAATCTTGGCG
GTCAAGGAGAAGATTTCAGGCGAAAAGGGCTGGGACCCCAAATACCAGAAGCTCATCTACTCTGGCAAAATTCTC
AAGGATGAGGAAACGGTCGCCTCCTACAACATCGAGGAGAAGGGCTTTGTCGTCTGCATGGTGAACAAGCCCAAG
GAGAAGCCCGCTGCCTCGTCCTCGGCCGCCGAACCCTCGGCCGCTCCTCCAGCAACTCCCGCCCAGCCTGTCGCC
AGCACCCCGGCGCCCCCTGCCGCCCCGTCTCAGTCCTCGTCGGCCCATGCAGCTGCGCCGGCCACCCCGACTCCC
CCGCGCGCGACCGAGGCTCAGCCCAGTGGCGGAAATGCCTCGGGCTTGGCCATGGGCGACGAACGTACCGAGGCG
ATTGCCAATATGGAAGCCATGGGGTTCGAGAGGCCTCATATAGAGGCTGCCATGCGCGCTGCCTTCAACAACCCC
GACCGTGCCGTCGAGTATCTACTGAATGGAATTCCGGACAACGTTCAACAGGAGCAACAGCAGCGCCGCGCTCCC
GCTGCTGCGTCCACCGGTGCGTCCGCGCAGTCTGCTCCACCGGCGCAAAGTGGAGAGGATGACGGAGGCGTGAAC
CTCTTCGACCTCGCTGCCCAACAGGGAGGCGGAGCCGCCCCTCGAGGTTCGGGCATGGGCTCTGCTGCCGCCGCC
GCCGCCGCCGCCGCCCAGGGTGGCGACCTGGGGAATCTGGACTTCCTCCGGCACAATGCACAGTTCCAGCAGCTC
CGCCAAGTCGTCCAGCAACAGCCGCAAATGCTGGAACCCATCCTGCAGCAGCTAGGTGCCGGCAATCCGCAGTTG
GCGCAGCTCATTGCCTCCAACCCCGACCAATTTCTTCAACTACTTGGAGAAAACGCCGACGACGACGTTCCCCTG
CCCCCTGGCGCGCAGGCCATCTCCGTCACCGAGGAGGAGCGAGACGCCATCGAGCGATTATGTCGGCTTGGATTC
GACCGAGATCAGGCCATCCAAGCCTACTTCGCCTGCGACAAGAACGAGGAGCTTGCTGCCAACTTCCTCTTTGAG
CAACCAGAGGACGAGGAGCCCCCCACAAACTAA
Transcript >Hirsu2|7096
ATGAAGGTCACATTTAGGGACTTGAAGCAGCAAAAGTTCACCCTCGAGGTTGAACCGACCGACCAAATCTTGGCG
GTCAAGGAGAAGATTTCAGGCGAAAAGGGCTGGGACCCCAAATACCAGAAGCTCATCTACTCTGGCAAAATTCTC
AAGGATGAGGAAACGGTCGCCTCCTACAACATCGAGGAGAAGGGCTTTGTCGTCTGCATGGTGAACAAGCCCAAG
GAGAAGCCCGCTGCCTCGTCCTCGGCCGCCGAACCCTCGGCCGCTCCTCCAGCAACTCCCGCCCAGCCTGTCGCC
AGCACCCCGGCGCCCCCTGCCGCCCCGTCTCAGTCCTCGTCGGCCCATGCAGCTGCGCCGGCCACCCCGACTCCC
CCGCGCGCGACCGAGGCTCAGCCCAGTGGCGGAAATGCCTCGGGCTTGGCCATGGGCGACGAACGTACCGAGGCG
ATTGCCAATATGGAAGCCATGGGGTTCGAGAGGCCTCATATAGAGGCTGCCATGCGCGCTGCCTTCAACAACCCC
GACCGTGCCGTCGAGTATCTACTGAATGGAATTCCGGACAACGTTCAACAGGAGCAACAGCAGCGCCGCGCTCCC
GCTGCTGCGTCCACCGGTGCGTCCGCGCAGTCTGCTCCACCGGCGCAAAGTGGAGAGGATGACGGAGGCGTGAAC
CTCTTCGACCTCGCTGCCCAACAGGGAGGCGGAGCCGCCCCTCGAGGTTCGGGCATGGGCTCTGCTGCCGCCGCC
GCCGCCGCCGCCGCCCAGGGTGGCGACCTGGGGAATCTGGACTTCCTCCGGCACAATGCACAGTTCCAGCAGCTC
CGCCAAGTCGTCCAGCAACAGCCGCAAATGCTGGAACCCATCCTGCAGCAGCTAGGTGCCGGCAATCCGCAGTTG
GCGCAGCTCATTGCCTCCAACCCCGACCAATTTCTTCAACTACTTGGAGAAAACGCCGACGACGACGTTCCCCTG
CCCCCTGGCGCGCAGGCCATCTCCGTCACCGAGGAGGAGCGAGACGCCATCGAGCGATTATGTCGGCTTGGATTC
GACCGAGATCAGGCCATCCAAGCCTACTTCGCCTGCGACAAGAACGAGGAGCTTGCTGCCAACTTCCTCTTTGAG
CAACCAGAGGACGAGGAGCCCCCCACAAACTAA
Gene >Hirsu2|7096
ATGAAGGTCACATTTAGGGTATGCGCTGCCGTCTCCATCGCCGGCGACAGAGGGCTGACCTTCCGCCCCTCGATA
GGACTTGAAGCAGCAAAAGTTCACCCTCGAGGTTGAACCGACCGACCAAGTAAGCCCGCCTGCTGCCTACATCGT
CCTGTCCATGACCCGACCGACCTGCCCTCAACAGACGTGTCCTCCTCCGGACTGCCTTCACTGACCCTCCACTGA
CCCTCCACTGACCTTCTCGAGCCGCTGCTCGAGCTCACTTGCCTTGTGCTGACCGTCCTGCCCCCCCGAAACAGA
TCTTGGCGGTCAAGGAGAAGATTTCAGGCGAAAAGGGCTGGGACCCCAAATACCAGAAGCTCATCTACTCTGGTA
AGGCGCGAAACCGATTCCCGTCCGTCCCCTCCCCGGCTGATCACCTGCGACAGGCAAAATTCTCAAGGATGAGGA
AACGGTCGCCTCCTACAACATCGAGGAGAAGGGCTTTGTCGTCTGCATGGTGAACAAGGTGCGACCATCCCTTAC
CCTGAACCCGGGGATTCCGAGAACTAACTTCTCCTCGCTGTCAGCCCAAGGAGAAGCCCGCTGCCTCGTCCTCGG
CCGCCGAACCCTCGGCCGCTCCTCCAGCAACTCCCGCCCAGCCTGTCGCCAGCACCCCGGCGCCCCCTGCCGCCC
CGTCTCAGTCCTCGTCGGCCCATGCAGCTGCGCCGGCCACCCCGACTCCCCCGCGCGCGACCGAGGCTCAGCCCA
GTGGCGGAAATGCCTCGGGCTTGGCCATGGGCGACGAACGTACCGAGGCGATTGCCAATATGGAAGCCATGGGGT
TCGAGAGGCCTCATATAGAGGCTGCCATGCGCGCTGCCTTCAACAACCCCGACCGTGCCGTCGAGTATCTACTGA
ATGTCCGTCTGCTCGCCAATTGTGCCGTCCTGGCTGACGTGCGACTGACTCTGCTTGATTAGGGAATTCCGGACA
ACGTTCAACAGGAGCAACAGCAGCGCCGCGCTCCCGCTGCTGCGTCCACCGGTGCGTCCGCGCAGTCTGCTCCAC
CGGCGCAAAGTGGAGAGGATGACGGAGGCGTGAACCTCTTCGACCTCGCTGCCCAACAGGGAGGCGGAGCCGCCC
CTCGAGGTTCGGGCATGGGCTCTGCTGCCGCCGCCGCCGCCGCCGCCGCCCAGGGTGGCGACCTGGGGAATCTGG
ACTTCCTCCGGCACAATGCACAGTTCCAGCAGCTCCGCCAAGTCGTCCAGCAACAGCCGCAAATGCTGGAACCCA
TCCTGCAGCAGCTAGGTGCCGGCAATCCGCAGTTGGCGCAGCTCATTGCCTCCAACCCCGACCAATTTCTTCAAC
TACTTGGAGAAAACGCCGACGACGACGTTCCCCTGCCCCCTGGCGCGCAGGCCATCTCCGTCACCGAGGAGGAGC
GAGACGCCATCGAGCGAGTACGTGCATCGCGTGTCCCCCAAGCAATGAAAGAAGCAAGGCTCGGCTAACAGACAG
CAGTTATGTCGGCTTGGATTCGACCGAGATCAGGCCATCCAAGCCTACTTCGCCTGCGACAAGAACGAGGAGCTT
GCTGCCAACTTCCTCTTTGAGCAACCAGAGGACGAGGAGCCCCCCACAAACTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail