Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|7096
Gene name
LocationContig_397:7333..8962
Strand-
Gene length (bp)1629
Transcript length (bp)1158
Coding sequence length (bp)1158
Protein length (aa) 386

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00627 UBA UBA/TS-N domain 9.1E-10 148 182
PF00627 UBA UBA/TS-N domain 2.2E-13 338 373
PF09280 XPC-binding XPC-binding domain 7.2E-24 263 318
PF00240 ubiquitin Ubiquitin family 1.4E-20 4 73
PF11976 Rad60-SLD Ubiquitin-2 like Rad60 SUMO-like 9.6E-07 1 64

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O74803|RHP23_SCHPO UV excision repair protein rhp23 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rhp23 PE=1 SV=1 1 381 2.0E-94
sp|Q84L33|RD23B_ARATH Ubiquitin receptor RAD23b OS=Arabidopsis thaliana GN=RAD23B PE=1 SV=3 1 381 7.0E-70
sp|Q84L32|RD23A_ARATH Probable ubiquitin receptor RAD23a OS=Arabidopsis thaliana GN=RAD23A PE=1 SV=2 1 381 1.0E-65
sp|P54728|RD23B_MOUSE UV excision repair protein RAD23 homolog B OS=Mus musculus GN=Rad23b PE=1 SV=2 1 381 5.0E-65
sp|P54727|RD23B_HUMAN UV excision repair protein RAD23 homolog B OS=Homo sapiens GN=RAD23B PE=1 SV=1 1 381 8.0E-65
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O74803|RHP23_SCHPO UV excision repair protein rhp23 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rhp23 PE=1 SV=1 1 381 2.0E-94
sp|Q84L33|RD23B_ARATH Ubiquitin receptor RAD23b OS=Arabidopsis thaliana GN=RAD23B PE=1 SV=3 1 381 7.0E-70
sp|Q84L32|RD23A_ARATH Probable ubiquitin receptor RAD23a OS=Arabidopsis thaliana GN=RAD23A PE=1 SV=2 1 381 1.0E-65
sp|P54728|RD23B_MOUSE UV excision repair protein RAD23 homolog B OS=Mus musculus GN=Rad23b PE=1 SV=2 1 381 5.0E-65
sp|P54727|RD23B_HUMAN UV excision repair protein RAD23 homolog B OS=Homo sapiens GN=RAD23B PE=1 SV=1 1 381 8.0E-65
sp|Q29RK4|RD23B_BOVIN UV excision repair protein RAD23 homolog B OS=Bos taurus GN=RAD23B PE=2 SV=1 1 381 2.0E-62
sp|Q4KMA2|RD23B_RAT UV excision repair protein RAD23 homolog B OS=Rattus norvegicus GN=Rad23b PE=1 SV=1 1 381 2.0E-62
sp|P32628|RAD23_YEAST UV excision repair protein RAD23 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RAD23 PE=1 SV=1 1 379 3.0E-60
sp|Q84L30|RD23D_ARATH Ubiquitin receptor RAD23d OS=Arabidopsis thaliana GN=RAD23D PE=1 SV=2 1 381 1.0E-58
sp|A3KMV2|RD23A_BOVIN UV excision repair protein RAD23 homolog A OS=Bos taurus GN=RAD23A PE=2 SV=1 1 381 5.0E-58
sp|P54725|RD23A_HUMAN UV excision repair protein RAD23 homolog A OS=Homo sapiens GN=RAD23A PE=1 SV=1 1 381 8.0E-58
sp|P54726|RD23A_MOUSE UV excision repair protein RAD23 homolog A OS=Mus musculus GN=Rad23a PE=1 SV=2 1 381 4.0E-57
sp|Q84L31|RD23C_ARATH Ubiquitin receptor RAD23c OS=Arabidopsis thaliana GN=RAD23C PE=1 SV=2 1 381 2.0E-55
sp|Q40742|RAD23_ORYSJ Probable ubiquitin receptor RAD23 OS=Oryza sativa subsp. japonica GN=RAD23 PE=1 SV=2 1 383 3.0E-55
sp|Q54LV1|RAD23_DICDI UV excision repair protein RAD23 homolog OS=Dictyostelium discoideum GN=rcbA PE=1 SV=1 266 380 2.0E-18
sp|Q54LV1|RAD23_DICDI UV excision repair protein RAD23 homolog OS=Dictyostelium discoideum GN=rcbA PE=1 SV=1 1 76 4.0E-13
sp|Q10169|DSK2_SCHPO Deubiquitination-protection protein dph1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dph1 PE=3 SV=1 1 187 8.0E-09
sp|P18101|RL40_DROME Ubiquitin-60S ribosomal protein L40 OS=Drosophila melanogaster GN=RpL40 PE=1 SV=2 1 64 1.0E-08
sp|P49633|RL40_ACACA Ubiquitin-60S ribosomal protein L40 OS=Acanthamoeba castellanii PE=2 SV=2 1 64 2.0E-08
sp|P0C276|RL40_SHEEP Ubiquitin-60S ribosomal protein L40 OS=Ovis aries GN=UBA52 PE=2 SV=2 1 64 2.0E-08
sp|P62986|RL40_RAT Ubiquitin-60S ribosomal protein L40 OS=Rattus norvegicus GN=Uba52 PE=1 SV=2 1 64 2.0E-08
sp|P0C275|RL40_PONPY Ubiquitin-60S ribosomal protein L40 OS=Pongo pygmaeus GN=UBA52 PE=2 SV=2 1 64 2.0E-08
sp|P63053|RL40_PIG Ubiquitin-60S ribosomal protein L40 OS=Sus scrofa GN=UBA52 PE=1 SV=2 1 64 2.0E-08
sp|P68205|RL40_OPHHA Ubiquitin-60S ribosomal protein L40 OS=Ophiophagus hannah PE=2 SV=2 1 64 2.0E-08
sp|P62984|RL40_MOUSE Ubiquitin-60S ribosomal protein L40 OS=Mus musculus GN=Uba52 PE=1 SV=2 1 64 2.0E-08
sp|P0C273|RL40_MACFA Ubiquitin-60S ribosomal protein L40 OS=Macaca fascicularis GN=UBA52 PE=2 SV=2 1 64 2.0E-08
sp|P62987|RL40_HUMAN Ubiquitin-60S ribosomal protein L40 OS=Homo sapiens GN=UBA52 PE=1 SV=2 1 64 2.0E-08
sp|P63052|RL40_FELCA Ubiquitin-60S ribosomal protein L40 OS=Felis catus GN=UBA52 PE=2 SV=2 1 64 2.0E-08
sp|P63050|RL40_CANLF Ubiquitin-60S ribosomal protein L40 OS=Canis lupus familiaris GN=UBA52 PE=2 SV=2 1 64 2.0E-08
sp|P63048|RL40_BOVIN Ubiquitin-60S ribosomal protein L40 OS=Bos taurus GN=UBA52 PE=1 SV=2 1 64 2.0E-08
sp|Q8SWD4|UBIQ_ENCCU Ubiquitin OS=Encephalitozoon cuniculi (strain GB-M1) GN=ECU02_0740i PE=1 SV=1 1 64 2.0E-08
sp|P62975|UBIQ_RABIT Ubiquitin OS=Oryctolagus cuniculus PE=1 SV=1 1 64 3.0E-08
sp|P68197|UBIQ_CERCA Ubiquitin OS=Ceratitis capitata PE=1 SV=1 1 64 3.0E-08
sp|Q865C5|UBIQ_CAMDR Ubiquitin OS=Camelus dromedarius PE=3 SV=2 1 64 3.0E-08
sp|P48510|DSK2_YEAST Ubiquitin domain-containing protein DSK2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DSK2 PE=1 SV=2 10 75 6.0E-08
sp|O65381|RUB3_ARATH NEDD8-like protein RUB3 OS=Arabidopsis thaliana GN=RUB3 PE=2 SV=1 1 71 6.0E-08
sp|P69317|UBIQ_LUPPO Ubiquitin OS=Lupinus polyphyllus PE=3 SV=2 1 64 8.0E-08
sp|P69313|UBIQ_HELAN Ubiquitin OS=Helianthus annuus PE=3 SV=2 1 64 8.0E-08
sp|Q42202|RL40B_ARATH Ubiquitin-60S ribosomal protein L40-2 OS=Arabidopsis thaliana GN=RPL40B PE=1 SV=2 1 64 9.0E-08
sp|B9DHA6|RL40A_ARATH Ubiquitin-60S ribosomal protein L40-1 OS=Arabidopsis thaliana GN=RPL40A PE=1 SV=1 1 64 9.0E-08
sp|P14794|RL40_DICDI Ubiquitin-60S ribosomal protein L40 OS=Dictyostelium discoideum GN=ubqB PE=1 SV=2 1 64 1.0E-07
sp|P69310|UBIQ_AVESA Ubiquitin OS=Avena sativa PE=1 SV=1 1 64 1.0E-07
sp|P49636|RL40_NICSY Ubiquitin-60S ribosomal protein L40 OS=Nicotiana sylvestris GN=UBICEP52-7 PE=2 SV=2 1 64 1.0E-07
sp|Q4PLJ0|NEDD8_RABIT NEDD8 OS=Oryctolagus cuniculus GN=NEDD8 PE=3 SV=1 1 61 1.0E-07
sp|Q15843|NEDD8_HUMAN NEDD8 OS=Homo sapiens GN=NEDD8 PE=1 SV=1 1 61 1.0E-07
sp|P61282|NEDD8_BOVIN NEDD8 OS=Bos taurus GN=NEDD8 PE=3 SV=1 1 61 1.0E-07
sp|Q05120|UBIL_NPVOP Ubiquitin-like protein OS=Orgyia pseudotsugata multicapsid polyhedrosis virus GN=V-UBI PE=3 SV=1 1 64 1.0E-07
sp|P51423|RL40_BRARP Ubiquitin-60S ribosomal protein L40 OS=Brassica rapa subsp. pekinensis PE=2 SV=2 1 64 1.0E-07
sp|P69326|UBIQ_WHEAT Ubiquitin OS=Triticum aestivum PE=3 SV=2 1 64 1.0E-07
sp|P0C224|RL40_NEUCR Ubiquitin-60S ribosomal protein L40 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=crp-79 PE=1 SV=2 1 64 2.0E-07
sp|P0CH10|RL403_CHLRE Ubiquitin-60S ribosomal protein L40 OS=Chlamydomonas reinhardtii GN=UBI3 PE=1 SV=1 1 64 2.0E-07
sp|P0CH11|RL401_CHLRE Ubiquitin-60S ribosomal protein L40 OS=Chlamydomonas reinhardtii GN=UBI1 PE=1 SV=1 1 64 2.0E-07
sp|P68203|RS27A_SPOFR Ubiquitin-40S ribosomal protein S27a OS=Spodoptera frugiperda PE=2 SV=2 1 63 2.0E-07
sp|P19848|UBIQ_COPCO Ubiquitin OS=Coprinellus congregatus PE=1 SV=1 1 64 2.0E-07
sp|P69201|RL40_LEIMA Ubiquitin-60S ribosomal protein L40 OS=Leishmania major GN=UB-EP52 PE=3 SV=2 1 64 2.0E-07
sp|P15357|RS27A_DROME Ubiquitin-40S ribosomal protein S27a OS=Drosophila melanogaster GN=RpS27A PE=1 SV=2 1 63 2.0E-07
sp|P23398|UBIQP_STRPU Polyubiquitin (Fragment) OS=Strongylocentrotus purpuratus PE=2 SV=2 1 63 2.0E-07
sp|P68200|RS27A_ICTPU Ubiquitin-40S ribosomal protein S27a OS=Ictalurus punctatus GN=rps27a PE=2 SV=2 1 63 3.0E-07
sp|P62979|RS27A_HUMAN Ubiquitin-40S ribosomal protein S27a OS=Homo sapiens GN=RPS27A PE=1 SV=2 1 63 3.0E-07
sp|P62978|RS27A_CAVPO Ubiquitin-40S ribosomal protein S27a OS=Cavia porcellus GN=RPS27A PE=1 SV=2 1 63 3.0E-07
sp|P62992|RS27A_BOVIN Ubiquitin-40S ribosomal protein S27a OS=Bos taurus GN=RPS27A PE=1 SV=2 1 63 3.0E-07
sp|P62982|RS27A_RAT Ubiquitin-40S ribosomal protein S27a OS=Rattus norvegicus GN=Rps27a PE=1 SV=2 1 63 3.0E-07
sp|P62983|RS27A_MOUSE Ubiquitin-40S ribosomal protein S27a OS=Mus musculus GN=Rps27a PE=1 SV=2 1 63 3.0E-07
sp|P0CH09|RL402_YEAST Ubiquitin-60S ribosomal protein L40 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPL40B PE=1 SV=1 1 64 3.0E-07
sp|P0CH08|RL401_YEAST Ubiquitin-60S ribosomal protein L40 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPL40A PE=1 SV=1 1 64 3.0E-07
sp|P79781|RS27A_CHICK Ubiquitin-40S ribosomal protein S27a OS=Gallus gallus GN=RPS27A PE=2 SV=3 1 63 3.0E-07
sp|P14795|RL40_TRYCR Ubiquitin-60S ribosomal protein L40 OS=Trypanosoma cruzi GN=FUS1 PE=2 SV=2 1 64 3.0E-07
sp|P29504|RS27A_MANSE Ubiquitin-40S ribosomal protein S27a OS=Manduca sexta PE=2 SV=2 1 63 3.0E-07
sp|P68202|RS27A_PLUXY Ubiquitin-40S ribosomal protein S27a OS=Plutella xylostella PE=2 SV=2 1 63 3.0E-07
sp|Q71UE8|NEDD8_RAT NEDD8 OS=Rattus norvegicus GN=Nedd8 PE=1 SV=1 1 61 3.0E-07
sp|P29595|NEDD8_MOUSE NEDD8 OS=Mus musculus GN=Nedd8 PE=1 SV=2 1 61 3.0E-07
sp|P49632|RL40_CAEEL Ubiquitin-60S ribosomal protein L40 OS=Caenorhabditis elegans GN=ubq-2 PE=3 SV=2 1 64 4.0E-07
sp|P0CH07|RL402_SCHPO Ubiquitin-60S ribosomal protein L40 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=uep1 PE=1 SV=1 1 64 4.0E-07
sp|P0CH06|RL401_SCHPO Ubiquitin-60S ribosomal protein L40 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ubi1 PE=1 SV=1 1 64 4.0E-07
sp|P62972|UBIQP_XENLA Polyubiquitin (Fragment) OS=Xenopus laevis PE=1 SV=2 1 63 5.0E-07
sp|P62972|UBIQP_XENLA Polyubiquitin (Fragment) OS=Xenopus laevis PE=1 SV=2 1 63 5.0E-07
sp|P46575|RL40_EIMBO Ubiquitin-60S ribosomal protein L40 OS=Eimeria bovis PE=2 SV=2 1 63 5.0E-07
sp|Q9ARZ9|R27AA_ORYSJ Ubiquitin-40S ribosomal protein S27a-1 OS=Oryza sativa subsp. japonica GN=RPS27AA PE=2 SV=1 1 63 8.0E-07
sp|P0CG86|RS271_HORVU Ubiquitin-40S ribosomal protein S27a OS=Hordeum vulgare GN=MUB1 PE=3 SV=1 1 63 9.0E-07
sp|P62981|RS27A_SOLTU Ubiquitin-40S ribosomal protein S27a OS=Solanum tuberosum GN=UBI3 PE=2 SV=2 1 63 9.0E-07
sp|P62980|RS27A_SOLLC Ubiquitin-40S ribosomal protein S27a OS=Solanum lycopersicum GN=UBI3 PE=3 SV=2 1 63 9.0E-07
sp|P51431|R27AB_ORYSJ Ubiquitin-40S ribosomal protein S27a-2 OS=Oryza sativa subsp. japonica GN=RPS27AB PE=2 SV=3 1 63 9.0E-07
sp|P22589|UBIQP_PHYIN Polyubiquitin OS=Phytophthora infestans PE=1 SV=2 1 63 9.0E-07
sp|P22589|UBIQP_PHYIN Polyubiquitin OS=Phytophthora infestans PE=1 SV=2 1 63 9.0E-07
sp|P22589|UBIQP_PHYIN Polyubiquitin OS=Phytophthora infestans PE=1 SV=2 1 63 9.0E-07
sp|P59232|R27AB_ARATH Ubiquitin-40S ribosomal protein S27a-2 OS=Arabidopsis thaliana GN=RPS27AB PE=1 SV=2 1 63 1.0E-06
sp|P0CG87|RS272_HORVU Ubiquitin-40S ribosomal protein S27a OS=Hordeum vulgare GN=MUB2 PE=3 SV=1 1 63 1.0E-06
sp|P0CG60|UBB_PONPY Polyubiquitin-B OS=Pongo pygmaeus GN=UBB PE=3 SV=1 1 63 1.0E-06
sp|P0CG60|UBB_PONPY Polyubiquitin-B OS=Pongo pygmaeus GN=UBB PE=3 SV=1 1 63 1.0E-06
sp|P0CG60|UBB_PONPY Polyubiquitin-B OS=Pongo pygmaeus GN=UBB PE=3 SV=1 1 63 1.0E-06
sp|P0CG65|UBB_PANTR Polyubiquitin-B OS=Pan troglodytes GN=UBB PE=3 SV=1 1 63 1.0E-06
sp|P0CG65|UBB_PANTR Polyubiquitin-B OS=Pan troglodytes GN=UBB PE=3 SV=1 1 63 1.0E-06
sp|P0CG65|UBB_PANTR Polyubiquitin-B OS=Pan troglodytes GN=UBB PE=3 SV=1 1 63 1.0E-06
sp|P0CG47|UBB_HUMAN Polyubiquitin-B OS=Homo sapiens GN=UBB PE=1 SV=1 1 63 1.0E-06
sp|P0CG47|UBB_HUMAN Polyubiquitin-B OS=Homo sapiens GN=UBB PE=1 SV=1 1 63 1.0E-06
sp|P0CG47|UBB_HUMAN Polyubiquitin-B OS=Homo sapiens GN=UBB PE=1 SV=1 1 63 1.0E-06
sp|P0CG67|UBB_GORGO Polyubiquitin-B OS=Gorilla gorilla gorilla GN=UBB PE=3 SV=1 1 63 1.0E-06
sp|P0CG67|UBB_GORGO Polyubiquitin-B OS=Gorilla gorilla gorilla GN=UBB PE=3 SV=1 1 63 1.0E-06
sp|P0CG67|UBB_GORGO Polyubiquitin-B OS=Gorilla gorilla gorilla GN=UBB PE=3 SV=1 1 63 1.0E-06
sp|P59233|R27AC_ARATH Ubiquitin-40S ribosomal protein S27a-3 OS=Arabidopsis thaliana GN=RPS27AC PE=1 SV=2 1 63 1.0E-06
sp|P84589|UBIQ_LUMTE Ubiquitin (Fragment) OS=Lumbricus terrestris PE=1 SV=2 14 64 1.0E-06
sp|Q9VJ33|NEDD8_DROME NEDD8 OS=Drosophila melanogaster GN=Nedd8 PE=1 SV=1 1 62 1.0E-06
sp|P27923|RS27A_MAIZE Ubiquitin-40S ribosomal protein S27a OS=Zea mays GN=UBF9 PE=2 SV=2 1 63 1.0E-06
sp|P47905|RS27A_LUPAL Ubiquitin-40S ribosomal protein S27a OS=Lupinus albus PE=3 SV=2 1 63 1.0E-06
sp|P0CH35|RL40B_ORYSJ Ubiquitin-60S ribosomal protein L40-2 OS=Oryza sativa subsp. japonica GN=Ub-CEP52-2 PE=3 SV=1 1 63 1.0E-06
sp|P0CH34|RL40A_ORYSJ Ubiquitin-60S ribosomal protein L40-1 OS=Oryza sativa subsp. japonica GN=Ub-CEP52-1 PE=2 SV=1 1 63 1.0E-06
sp|P21899|RL40_TRYBB Ubiquitin-60S ribosomal protein L40 OS=Trypanosoma brucei brucei PE=1 SV=2 1 64 1.0E-06
sp|P59272|RS27A_DAUCA Ubiquitin-40S ribosomal protein S27a (Fragment) OS=Daucus carota PE=2 SV=2 1 63 1.0E-06
sp|P40909|RL40_CRYNJ Ubiquitin-60S ribosomal protein L40 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=UBI1 PE=1 SV=2 1 63 1.0E-06
sp|P59271|R27AA_ARATH Ubiquitin-40S ribosomal protein S27a-1 OS=Arabidopsis thaliana GN=RPS27AA PE=1 SV=2 1 63 2.0E-06
sp|P0CG55|UBB_SHEEP Polyubiquitin-B OS=Ovis aries GN=UBB PE=2 SV=1 1 63 2.0E-06
sp|P0CG55|UBB_SHEEP Polyubiquitin-B OS=Ovis aries GN=UBB PE=2 SV=1 1 63 2.0E-06
sp|P0CG55|UBB_SHEEP Polyubiquitin-B OS=Ovis aries GN=UBB PE=2 SV=1 1 63 2.0E-06
sp|P0CG55|UBB_SHEEP Polyubiquitin-B OS=Ovis aries GN=UBB PE=2 SV=1 1 63 2.0E-06
sp|P14799|RS27A_NEUCR Ubiquitin-40S ribosomal protein S27a OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=ubi::crp-6 PE=1 SV=4 1 63 2.0E-06
sp|P0CG53|UBB_BOVIN Polyubiquitin-B OS=Bos taurus GN=UBB PE=1 SV=1 1 63 2.0E-06
sp|P0CG53|UBB_BOVIN Polyubiquitin-B OS=Bos taurus GN=UBB PE=1 SV=1 1 63 2.0E-06
sp|P0CG53|UBB_BOVIN Polyubiquitin-B OS=Bos taurus GN=UBB PE=1 SV=1 1 63 2.0E-06
sp|P0CG53|UBB_BOVIN Polyubiquitin-B OS=Bos taurus GN=UBB PE=1 SV=1 1 63 2.0E-06
sp|Q8MKD1|UBB_HORSE Polyubiquitin-B OS=Equus caballus GN=UBB PE=2 SV=3 1 63 2.0E-06
sp|Q8MKD1|UBB_HORSE Polyubiquitin-B OS=Equus caballus GN=UBB PE=2 SV=3 1 63 2.0E-06
sp|Q8MKD1|UBB_HORSE Polyubiquitin-B OS=Equus caballus GN=UBB PE=2 SV=3 1 63 2.0E-06
sp|P0CG54|UBB_CAVPO Polyubiquitin-B OS=Cavia porcellus GN=UBB PE=2 SV=1 1 63 2.0E-06
sp|P0CG54|UBB_CAVPO Polyubiquitin-B OS=Cavia porcellus GN=UBB PE=2 SV=1 1 63 2.0E-06
sp|P0CG54|UBB_CAVPO Polyubiquitin-B OS=Cavia porcellus GN=UBB PE=2 SV=1 1 63 2.0E-06
sp|P0CG54|UBB_CAVPO Polyubiquitin-B OS=Cavia porcellus GN=UBB PE=2 SV=1 1 63 2.0E-06
sp|P0CG51|UBB_RAT Polyubiquitin-B OS=Rattus norvegicus GN=Ubb PE=1 SV=1 1 63 2.0E-06
sp|P0CG51|UBB_RAT Polyubiquitin-B OS=Rattus norvegicus GN=Ubb PE=1 SV=1 1 63 2.0E-06
sp|P0CG51|UBB_RAT Polyubiquitin-B OS=Rattus norvegicus GN=Ubb PE=1 SV=1 1 63 2.0E-06
sp|P0CG51|UBB_RAT Polyubiquitin-B OS=Rattus norvegicus GN=Ubb PE=1 SV=1 1 63 2.0E-06
sp|P0CG49|UBB_MOUSE Polyubiquitin-B OS=Mus musculus GN=Ubb PE=2 SV=1 1 63 2.0E-06
sp|P0CG49|UBB_MOUSE Polyubiquitin-B OS=Mus musculus GN=Ubb PE=2 SV=1 1 63 2.0E-06
sp|P0CG49|UBB_MOUSE Polyubiquitin-B OS=Mus musculus GN=Ubb PE=2 SV=1 1 63 2.0E-06
sp|P0CG49|UBB_MOUSE Polyubiquitin-B OS=Mus musculus GN=Ubb PE=2 SV=1 1 63 2.0E-06
sp|P0CG62|UBB_CHICK Polyubiquitin-B OS=Gallus gallus GN=UBB PE=2 SV=1 1 63 2.0E-06
sp|P0CG62|UBB_CHICK Polyubiquitin-B OS=Gallus gallus GN=UBB PE=2 SV=1 1 63 2.0E-06
sp|P0CG62|UBB_CHICK Polyubiquitin-B OS=Gallus gallus GN=UBB PE=2 SV=1 1 63 2.0E-06
sp|P0CG62|UBB_CHICK Polyubiquitin-B OS=Gallus gallus GN=UBB PE=2 SV=1 1 63 2.0E-06
sp|P05759|RS27A_YEAST Ubiquitin-40S ribosomal protein S31 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPS31 PE=1 SV=3 1 63 3.0E-06
sp|P0C031|RUB2_ORYSJ Ubiquitin-NEDD8-like protein RUB2 OS=Oryza sativa subsp. japonica GN=RUB2 PE=2 SV=2 1 63 3.0E-06
sp|P0C032|RUB3_ORYSJ Ubiquitin-like protein-NEDD8-like protein RUB3 OS=Oryza sativa subsp. japonica GN=RUB3 PE=3 SV=2 1 63 3.0E-06
sp|Q8RUC6|RUB2_ARATH Ubiquitin-NEDD8-like protein RUB2 OS=Arabidopsis thaliana GN=RUB2 PE=1 SV=3 1 63 3.0E-06
sp|P0CG83|UBIQP_HORVU Polyubiquitin (Fragment) OS=Hordeum vulgare PE=2 SV=1 1 63 3.0E-06
sp|P0CG83|UBIQP_HORVU Polyubiquitin (Fragment) OS=Hordeum vulgare PE=2 SV=1 1 63 3.0E-06
sp|Q9SHE7|RUB1_ARATH Ubiquitin-NEDD8-like protein RUB1 OS=Arabidopsis thaliana GN=RUB1 PE=1 SV=3 1 63 3.0E-06
sp|P0CG68|UBC_PIG Polyubiquitin-C OS=Sus scrofa GN=UBC PE=2 SV=1 1 63 3.0E-06
sp|P0CG68|UBC_PIG Polyubiquitin-C OS=Sus scrofa GN=UBC PE=2 SV=1 1 63 3.0E-06
sp|P0CG68|UBC_PIG Polyubiquitin-C OS=Sus scrofa GN=UBC PE=2 SV=1 1 63 3.0E-06
sp|P0CG68|UBC_PIG Polyubiquitin-C OS=Sus scrofa GN=UBC PE=2 SV=1 1 63 3.0E-06
sp|P0CG68|UBC_PIG Polyubiquitin-C OS=Sus scrofa GN=UBC PE=2 SV=1 1 63 3.0E-06
sp|P0CG68|UBC_PIG Polyubiquitin-C OS=Sus scrofa GN=UBC PE=2 SV=1 1 63 3.0E-06
sp|P0CG66|UBC_GORGO Polyubiquitin-C OS=Gorilla gorilla gorilla GN=UBC PE=3 SV=1 1 63 3.0E-06
sp|P0CG66|UBC_GORGO Polyubiquitin-C OS=Gorilla gorilla gorilla GN=UBC PE=3 SV=1 1 63 3.0E-06
sp|P0CG66|UBC_GORGO Polyubiquitin-C OS=Gorilla gorilla gorilla GN=UBC PE=3 SV=1 1 63 3.0E-06
sp|P0CG66|UBC_GORGO Polyubiquitin-C OS=Gorilla gorilla gorilla GN=UBC PE=3 SV=1 1 63 3.0E-06
sp|P0CG66|UBC_GORGO Polyubiquitin-C OS=Gorilla gorilla gorilla GN=UBC PE=3 SV=1 1 63 3.0E-06
sp|P0CG66|UBC_GORGO Polyubiquitin-C OS=Gorilla gorilla gorilla GN=UBC PE=3 SV=1 1 63 3.0E-06
sp|P0CG66|UBC_GORGO Polyubiquitin-C OS=Gorilla gorilla gorilla GN=UBC PE=3 SV=1 1 63 3.0E-06
sp|P0CG66|UBC_GORGO Polyubiquitin-C OS=Gorilla gorilla gorilla GN=UBC PE=3 SV=1 1 63 3.0E-06
sp|P69200|RL40_LEITA Ubiquitin-60S ribosomal protein L40 OS=Leishmania tarentolae GN=UB-EP52 PE=3 SV=2 1 64 3.0E-06
sp|P0C073|RUB1_DESAN Ubiquitin-NEDD8-like protein RUB1 OS=Deschampsia antarctica GN=RUB1 PE=2 SV=2 1 63 3.0E-06
sp|P0C8R3|RS27B_SCHPO Ubiquitin-40S ribosomal protein S27b OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ubi5 PE=1 SV=2 1 63 3.0E-06
sp|P62976|UBIQP_CRIGR Polyubiquitin OS=Cricetulus griseus PE=2 SV=2 1 63 3.0E-06
sp|P0CG69|UBIQP_DROME Polyubiquitin OS=Drosophila melanogaster GN=Ubi-p63E PE=3 SV=1 1 63 3.0E-06
sp|P0CG69|UBIQP_DROME Polyubiquitin OS=Drosophila melanogaster GN=Ubi-p63E PE=3 SV=1 1 63 3.0E-06
sp|P0CG69|UBIQP_DROME Polyubiquitin OS=Drosophila melanogaster GN=Ubi-p63E PE=3 SV=1 1 63 3.0E-06
sp|P0CG69|UBIQP_DROME Polyubiquitin OS=Drosophila melanogaster GN=Ubi-p63E PE=3 SV=1 1 63 3.0E-06
sp|P0CG69|UBIQP_DROME Polyubiquitin OS=Drosophila melanogaster GN=Ubi-p63E PE=3 SV=1 1 63 3.0E-06
sp|P0CG69|UBIQP_DROME Polyubiquitin OS=Drosophila melanogaster GN=Ubi-p63E PE=3 SV=1 1 63 3.0E-06
sp|P0CG69|UBIQP_DROME Polyubiquitin OS=Drosophila melanogaster GN=Ubi-p63E PE=3 SV=1 1 63 3.0E-06
sp|P0CG69|UBIQP_DROME Polyubiquitin OS=Drosophila melanogaster GN=Ubi-p63E PE=3 SV=1 1 63 3.0E-06
sp|P0CG69|UBIQP_DROME Polyubiquitin OS=Drosophila melanogaster GN=Ubi-p63E PE=3 SV=1 1 63 3.0E-06
sp|P0CG69|UBIQP_DROME Polyubiquitin OS=Drosophila melanogaster GN=Ubi-p63E PE=3 SV=1 1 63 3.0E-06
sp|P0CG48|UBC_HUMAN Polyubiquitin-C OS=Homo sapiens GN=UBC PE=1 SV=3 1 63 3.0E-06
sp|P0CG48|UBC_HUMAN Polyubiquitin-C OS=Homo sapiens GN=UBC PE=1 SV=3 1 63 3.0E-06
sp|P0CG48|UBC_HUMAN Polyubiquitin-C OS=Homo sapiens GN=UBC PE=1 SV=3 1 63 3.0E-06
sp|P0CG48|UBC_HUMAN Polyubiquitin-C OS=Homo sapiens GN=UBC PE=1 SV=3 1 63 3.0E-06
sp|P0CG48|UBC_HUMAN Polyubiquitin-C OS=Homo sapiens GN=UBC PE=1 SV=3 1 63 3.0E-06
sp|P0CG48|UBC_HUMAN Polyubiquitin-C OS=Homo sapiens GN=UBC PE=1 SV=3 1 63 3.0E-06
sp|P0CG48|UBC_HUMAN Polyubiquitin-C OS=Homo sapiens GN=UBC PE=1 SV=3 1 63 3.0E-06
sp|P0CG48|UBC_HUMAN Polyubiquitin-C OS=Homo sapiens GN=UBC PE=1 SV=3 1 63 3.0E-06
sp|P0CG48|UBC_HUMAN Polyubiquitin-C OS=Homo sapiens GN=UBC PE=1 SV=3 1 63 3.0E-06
sp|P0C030|RUB1_ORYSJ Ubiquitin-NEDD8-like protein RUB1 OS=Oryza sativa subsp. japonica GN=RUB1 PE=2 SV=2 1 63 3.0E-06
sp|P0C016|RS27A_SCHPO Ubiquitin-40S ribosomal protein S27a OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ubi3 PE=1 SV=2 1 63 3.0E-06
sp|P62976|UBIQP_CRIGR Polyubiquitin OS=Cricetulus griseus PE=2 SV=2 1 63 4.0E-06
sp|P62976|UBIQP_CRIGR Polyubiquitin OS=Cricetulus griseus PE=2 SV=2 1 63 4.0E-06
sp|P62976|UBIQP_CRIGR Polyubiquitin OS=Cricetulus griseus PE=2 SV=2 1 63 4.0E-06
sp|P62976|UBIQP_CRIGR Polyubiquitin OS=Cricetulus griseus PE=2 SV=2 1 63 4.0E-06
sp|P62976|UBIQP_CRIGR Polyubiquitin OS=Cricetulus griseus PE=2 SV=2 1 63 4.0E-06
sp|P62976|UBIQP_CRIGR Polyubiquitin OS=Cricetulus griseus PE=2 SV=2 1 63 4.0E-06
sp|P62976|UBIQP_CRIGR Polyubiquitin OS=Cricetulus griseus PE=2 SV=2 1 63 4.0E-06
sp|P0CH28|UBC_BOVIN Polyubiquitin-C OS=Bos taurus GN=UBC PE=1 SV=1 1 63 4.0E-06
sp|P0CH28|UBC_BOVIN Polyubiquitin-C OS=Bos taurus GN=UBC PE=1 SV=1 1 63 4.0E-06
sp|P0CH28|UBC_BOVIN Polyubiquitin-C OS=Bos taurus GN=UBC PE=1 SV=1 1 63 4.0E-06
sp|P0CH28|UBC_BOVIN Polyubiquitin-C OS=Bos taurus GN=UBC PE=1 SV=1 1 63 4.0E-06
sp|P0CH28|UBC_BOVIN Polyubiquitin-C OS=Bos taurus GN=UBC PE=1 SV=1 1 63 4.0E-06
sp|P0CH28|UBC_BOVIN Polyubiquitin-C OS=Bos taurus GN=UBC PE=1 SV=1 1 63 4.0E-06
sp|P0CH28|UBC_BOVIN Polyubiquitin-C OS=Bos taurus GN=UBC PE=1 SV=1 1 63 4.0E-06
sp|P0CH28|UBC_BOVIN Polyubiquitin-C OS=Bos taurus GN=UBC PE=1 SV=1 1 63 4.0E-06
sp|P0CG61|UBC_PONPY Polyubiquitin-C OS=Pongo pygmaeus GN=UBC PE=3 SV=1 1 63 4.0E-06
sp|P0CG61|UBC_PONPY Polyubiquitin-C OS=Pongo pygmaeus GN=UBC PE=3 SV=1 1 63 4.0E-06
sp|P0CG61|UBC_PONPY Polyubiquitin-C OS=Pongo pygmaeus GN=UBC PE=3 SV=1 1 63 4.0E-06
sp|P0CG61|UBC_PONPY Polyubiquitin-C OS=Pongo pygmaeus GN=UBC PE=3 SV=1 1 63 4.0E-06
sp|P0CG61|UBC_PONPY Polyubiquitin-C OS=Pongo pygmaeus GN=UBC PE=3 SV=1 1 63 4.0E-06
sp|P0CG61|UBC_PONPY Polyubiquitin-C OS=Pongo pygmaeus GN=UBC PE=3 SV=1 1 63 4.0E-06
sp|P0CG61|UBC_PONPY Polyubiquitin-C OS=Pongo pygmaeus GN=UBC PE=3 SV=1 1 63 4.0E-06
sp|P0CG61|UBC_PONPY Polyubiquitin-C OS=Pongo pygmaeus GN=UBC PE=3 SV=1 1 63 4.0E-06
sp|P0CG61|UBC_PONPY Polyubiquitin-C OS=Pongo pygmaeus GN=UBC PE=3 SV=1 1 63 4.0E-06
sp|P0CG61|UBC_PONPY Polyubiquitin-C OS=Pongo pygmaeus GN=UBC PE=3 SV=1 1 63 4.0E-06
sp|P0CG64|UBC_PANTR Polyubiquitin-C OS=Pan troglodytes GN=UBC PE=3 SV=1 1 63 4.0E-06
sp|P0CG64|UBC_PANTR Polyubiquitin-C OS=Pan troglodytes GN=UBC PE=3 SV=1 1 63 4.0E-06
sp|P0CG64|UBC_PANTR Polyubiquitin-C OS=Pan troglodytes GN=UBC PE=3 SV=1 1 63 4.0E-06
sp|P0CG64|UBC_PANTR Polyubiquitin-C OS=Pan troglodytes GN=UBC PE=3 SV=1 1 63 4.0E-06
sp|P0CG64|UBC_PANTR Polyubiquitin-C OS=Pan troglodytes GN=UBC PE=3 SV=1 1 63 4.0E-06
sp|P0CG64|UBC_PANTR Polyubiquitin-C OS=Pan troglodytes GN=UBC PE=3 SV=1 1 63 4.0E-06
sp|P0CG64|UBC_PANTR Polyubiquitin-C OS=Pan troglodytes GN=UBC PE=3 SV=1 1 63 4.0E-06
sp|P0CG64|UBC_PANTR Polyubiquitin-C OS=Pan troglodytes GN=UBC PE=3 SV=1 1 63 4.0E-06
sp|P0CG64|UBC_PANTR Polyubiquitin-C OS=Pan troglodytes GN=UBC PE=3 SV=1 1 63 4.0E-06
sp|P0CG64|UBC_PANTR Polyubiquitin-C OS=Pan troglodytes GN=UBC PE=3 SV=1 1 63 4.0E-06
sp|Q63429|UBC_RAT Polyubiquitin-C OS=Rattus norvegicus GN=Ubc PE=1 SV=1 1 63 4.0E-06
sp|Q63429|UBC_RAT Polyubiquitin-C OS=Rattus norvegicus GN=Ubc PE=1 SV=1 1 63 4.0E-06
sp|Q63429|UBC_RAT Polyubiquitin-C OS=Rattus norvegicus GN=Ubc PE=1 SV=1 1 63 4.0E-06
sp|Q63429|UBC_RAT Polyubiquitin-C OS=Rattus norvegicus GN=Ubc PE=1 SV=1 1 63 4.0E-06
sp|Q63429|UBC_RAT Polyubiquitin-C OS=Rattus norvegicus GN=Ubc PE=1 SV=1 1 63 4.0E-06
sp|Q63429|UBC_RAT Polyubiquitin-C OS=Rattus norvegicus GN=Ubc PE=1 SV=1 1 63 4.0E-06
sp|Q63429|UBC_RAT Polyubiquitin-C OS=Rattus norvegicus GN=Ubc PE=1 SV=1 1 63 4.0E-06
sp|Q63429|UBC_RAT Polyubiquitin-C OS=Rattus norvegicus GN=Ubc PE=1 SV=1 1 63 4.0E-06
sp|Q63429|UBC_RAT Polyubiquitin-C OS=Rattus norvegicus GN=Ubc PE=1 SV=1 1 63 4.0E-06
sp|Q63429|UBC_RAT Polyubiquitin-C OS=Rattus norvegicus GN=Ubc PE=1 SV=1 1 63 4.0E-06
sp|P0CG50|UBC_MOUSE Polyubiquitin-C OS=Mus musculus GN=Ubc PE=1 SV=2 1 63 4.0E-06
sp|P0CG50|UBC_MOUSE Polyubiquitin-C OS=Mus musculus GN=Ubc PE=1 SV=2 1 63 4.0E-06
sp|P0CG50|UBC_MOUSE Polyubiquitin-C OS=Mus musculus GN=Ubc PE=1 SV=2 1 63 4.0E-06
sp|P0CG50|UBC_MOUSE Polyubiquitin-C OS=Mus musculus GN=Ubc PE=1 SV=2 1 63 4.0E-06
sp|P0CG50|UBC_MOUSE Polyubiquitin-C OS=Mus musculus GN=Ubc PE=1 SV=2 1 63 4.0E-06
sp|P0CG50|UBC_MOUSE Polyubiquitin-C OS=Mus musculus GN=Ubc PE=1 SV=2 1 63 4.0E-06
sp|P0CG50|UBC_MOUSE Polyubiquitin-C OS=Mus musculus GN=Ubc PE=1 SV=2 1 63 4.0E-06
sp|P0CG50|UBC_MOUSE Polyubiquitin-C OS=Mus musculus GN=Ubc PE=1 SV=2 1 63 4.0E-06
sp|P0CG50|UBC_MOUSE Polyubiquitin-C OS=Mus musculus GN=Ubc PE=1 SV=2 1 63 4.0E-06
sp|P69061|RS27A_KLULA Ubiquitin-40S ribosomal protein S27a OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=ubi3 PE=1 SV=2 1 63 4.0E-06
sp|P0CG68|UBC_PIG Polyubiquitin-C OS=Sus scrofa GN=UBC PE=2 SV=1 1 63 5.0E-06
sp|P0DJ25|RL40_TETTS Ubiquitin-60S ribosomal protein L40 OS=Tetrahymena thermophila (strain SB210) GN=RPL40 PE=1 SV=1 1 63 5.0E-06
sp|P33190|RL40_TETPY Ubiquitin-60S ribosomal protein L40 OS=Tetrahymena pyriformis GN=TUF11 PE=3 SV=2 1 63 5.0E-06
sp|P0C031|RUB2_ORYSJ Ubiquitin-NEDD8-like protein RUB2 OS=Oryza sativa subsp. japonica GN=RUB2 PE=2 SV=2 3 71 6.0E-06
sp|P0C073|RUB1_DESAN Ubiquitin-NEDD8-like protein RUB1 OS=Deschampsia antarctica GN=RUB1 PE=2 SV=2 3 71 6.0E-06
sp|P0CH28|UBC_BOVIN Polyubiquitin-C OS=Bos taurus GN=UBC PE=1 SV=1 1 63 6.0E-06
sp|P0CH33|UBQ11_ARATH Polyubiquitin 11 OS=Arabidopsis thaliana GN=UBQ11 PE=1 SV=1 1 63 6.0E-06
sp|P0CH33|UBQ11_ARATH Polyubiquitin 11 OS=Arabidopsis thaliana GN=UBQ11 PE=1 SV=1 1 63 6.0E-06
sp|P0CH33|UBQ11_ARATH Polyubiquitin 11 OS=Arabidopsis thaliana GN=UBQ11 PE=1 SV=1 1 63 6.0E-06
sp|P69315|UBIQP_LINUS Polyubiquitin (Fragment) OS=Linum usitatissimum PE=3 SV=2 1 63 6.0E-06
sp|Q8MKD1|UBB_HORSE Polyubiquitin-B OS=Equus caballus GN=UBB PE=2 SV=3 1 63 7.0E-06
sp|Q8R317|UBQL1_MOUSE Ubiquilin-1 OS=Mus musculus GN=Ubqln1 PE=1 SV=1 1 116 7.0E-06
sp|P0C030|RUB1_ORYSJ Ubiquitin-NEDD8-like protein RUB1 OS=Oryza sativa subsp. japonica GN=RUB1 PE=2 SV=2 3 71 8.0E-06
sp|P14797|RS27A_DICDI Ubiquitin-40S ribosomal protein S27a OS=Dictyostelium discoideum GN=ubqC PE=1 SV=2 1 63 8.0E-06
sp|Q9YHD3|BAG6A_XENLA Large proline-rich protein bag6-A OS=Xenopus laevis GN=Bag6-a PE=2 SV=1 1 73 8.0E-06
sp|Q9SHE7|RUB1_ARATH Ubiquitin-NEDD8-like protein RUB1 OS=Arabidopsis thaliana GN=RUB1 PE=1 SV=3 3 71 9.0E-06
sp|P69315|UBIQP_LINUS Polyubiquitin (Fragment) OS=Linum usitatissimum PE=3 SV=2 1 63 9.0E-06
sp|P69315|UBIQP_LINUS Polyubiquitin (Fragment) OS=Linum usitatissimum PE=3 SV=2 1 63 9.0E-06
sp|Q1EC66|UBQ3_ARATH Polyubiquitin 3 OS=Arabidopsis thaliana GN=UBQ3 PE=1 SV=1 1 63 9.0E-06
sp|Q1EC66|UBQ3_ARATH Polyubiquitin 3 OS=Arabidopsis thaliana GN=UBQ3 PE=1 SV=1 1 63 9.0E-06
sp|Q1EC66|UBQ3_ARATH Polyubiquitin 3 OS=Arabidopsis thaliana GN=UBQ3 PE=1 SV=1 1 63 9.0E-06
sp|Q1EC66|UBQ3_ARATH Polyubiquitin 3 OS=Arabidopsis thaliana GN=UBQ3 PE=1 SV=1 1 63 9.0E-06
sp|Q3E7T8|UBQ14_ARATH Polyubiquitin 14 OS=Arabidopsis thaliana GN=UBQ14 PE=1 SV=2 1 63 9.0E-06
sp|Q3E7T8|UBQ14_ARATH Polyubiquitin 14 OS=Arabidopsis thaliana GN=UBQ14 PE=1 SV=2 1 63 9.0E-06
sp|Q3E7T8|UBQ14_ARATH Polyubiquitin 14 OS=Arabidopsis thaliana GN=UBQ14 PE=1 SV=2 1 63 9.0E-06
sp|Q3E7T8|UBQ14_ARATH Polyubiquitin 14 OS=Arabidopsis thaliana GN=UBQ14 PE=1 SV=2 1 63 9.0E-06
sp|P69325|UBIQP_SOYBN Polyubiquitin OS=Glycine max GN=SUBI-1 PE=2 SV=2 1 63 9.0E-06
sp|P69325|UBIQP_SOYBN Polyubiquitin OS=Glycine max GN=SUBI-1 PE=2 SV=2 1 63 9.0E-06
sp|P69325|UBIQP_SOYBN Polyubiquitin OS=Glycine max GN=SUBI-1 PE=2 SV=2 1 63 9.0E-06
sp|P69325|UBIQP_SOYBN Polyubiquitin OS=Glycine max GN=SUBI-1 PE=2 SV=2 1 63 9.0E-06
sp|Q93725|NEDD8_CAEEL NEDD8 OS=Caenorhabditis elegans GN=ned-8 PE=1 SV=1 1 61 9.0E-06
sp|P0CG73|UBI1P_CANAX Polyubiquitin OS=Candida albicans GN=UBI1 PE=1 SV=1 1 63 9.0E-06
sp|P0CG73|UBI1P_CANAX Polyubiquitin OS=Candida albicans GN=UBI1 PE=1 SV=1 1 63 9.0E-06
sp|P0CG73|UBI1P_CANAX Polyubiquitin OS=Candida albicans GN=UBI1 PE=1 SV=1 1 63 9.0E-06
sp|P69309|UBIQP_AVEFA Polyubiquitin OS=Avena fatua PE=2 SV=2 1 63 9.0E-06
sp|P69309|UBIQP_AVEFA Polyubiquitin OS=Avena fatua PE=2 SV=2 1 63 9.0E-06
sp|P69309|UBIQP_AVEFA Polyubiquitin OS=Avena fatua PE=2 SV=2 1 63 9.0E-06
sp|P69309|UBIQP_AVEFA Polyubiquitin OS=Avena fatua PE=2 SV=2 1 63 9.0E-06
sp|P0CG70|UBI4P_NEUCR Polyubiquitin OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=ubi PE=1 SV=1 1 63 9.0E-06
sp|P0CG70|UBI4P_NEUCR Polyubiquitin OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=ubi PE=1 SV=1 1 63 9.0E-06
sp|P0CG70|UBI4P_NEUCR Polyubiquitin OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=ubi PE=1 SV=1 1 63 9.0E-06
sp|P0CG70|UBI4P_NEUCR Polyubiquitin OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=ubi PE=1 SV=1 1 63 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0006289 nucleotide-excision repair Yes
GO:0005515 protein binding Yes
GO:0003684 damaged DNA binding Yes
GO:0043161 proteasome-mediated ubiquitin-dependent protein catabolic process Yes
GO:1901363 heterocyclic compound binding No
GO:0003677 DNA binding No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0006281 DNA repair No
GO:0003676 nucleic acid binding No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0009056 catabolic process No
GO:0006950 response to stress No
GO:0006511 ubiquitin-dependent protein catabolic process No
GO:1901565 organonitrogen compound catabolic process No
GO:0071704 organic substance metabolic process No
GO:0030163 protein catabolic process No
GO:0006508 proteolysis No
GO:0005488 binding No
GO:0019538 protein metabolic process No
GO:0051716 cellular response to stimulus No
GO:0010498 proteasomal protein catabolic process No
GO:0008150 biological_process No
GO:0046483 heterocycle metabolic process No
GO:0050896 response to stimulus No
GO:1901575 organic substance catabolic process No
GO:0044238 primary metabolic process No
GO:0090304 nucleic acid metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0044237 cellular metabolic process No
GO:0043632 modification-dependent macromolecule catabolic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0003674 molecular_function No
GO:0051603 proteolysis involved in protein catabolic process No
GO:0006974 cellular response to DNA damage stimulus No
GO:1901564 organonitrogen compound metabolic process No
GO:0009057 macromolecule catabolic process No
GO:0044248 cellular catabolic process No
GO:0044265 cellular macromolecule catabolic process No
GO:0033554 cellular response to stress No
GO:0006807 nitrogen compound metabolic process No
GO:0006259 DNA metabolic process No
GO:0019941 modification-dependent protein catabolic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0008152 metabolic process No
GO:0097159 organic cyclic compound binding No
GO:0009987 cellular process No
GO:0044260 cellular macromolecule metabolic process No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus 0.6811 0.8267 0.0345 0.0193 0.1066 0.0069 0.2806 0.075 0.1091 0.0118

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup3671
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1314
Ophiocordyceps australis map64 (Brazil) OphauB2|5170
Ophiocordyceps camponoti-floridani Ophcf2|06519
Ophiocordyceps camponoti-rufipedis Ophun1|6659
Ophiocordyceps kimflemingae Ophio5|6604
Ophiocordyceps subramaniannii Hirsu2|7096 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|7096
MKVTFRDLKQQKFTLEVEPTDQILAVKEKISGEKGWDPKYQKLIYSGKILKDEETVASYNIEEKGFVVCMVNKPK
EKPAASSSAAEPSAAPPATPAQPVASTPAPPAAPSQSSSAHAAAPATPTPPRATEAQPSGGNASGLAMGDERTEA
IANMEAMGFERPHIEAAMRAAFNNPDRAVEYLLNGIPDNVQQEQQQRRAPAAASTGASAQSAPPAQSGEDDGGVN
LFDLAAQQGGGAAPRGSGMGSAAAAAAAAAQGGDLGNLDFLRHNAQFQQLRQVVQQQPQMLEPILQQLGAGNPQL
AQLIASNPDQFLQLLGENADDDVPLPPGAQAISVTEEERDAIERLCRLGFDRDQAIQAYFACDKNEELAANFLFE
QPEDEEPPTN*
Coding >Hirsu2|7096
ATGAAGGTCACATTTAGGGACTTGAAGCAGCAAAAGTTCACCCTCGAGGTTGAACCGACCGACCAAATCTTGGCG
GTCAAGGAGAAGATTTCAGGCGAAAAGGGCTGGGACCCCAAATACCAGAAGCTCATCTACTCTGGCAAAATTCTC
AAGGATGAGGAAACGGTCGCCTCCTACAACATCGAGGAGAAGGGCTTTGTCGTCTGCATGGTGAACAAGCCCAAG
GAGAAGCCCGCTGCCTCGTCCTCGGCCGCCGAACCCTCGGCCGCTCCTCCAGCAACTCCCGCCCAGCCTGTCGCC
AGCACCCCGGCGCCCCCTGCCGCCCCGTCTCAGTCCTCGTCGGCCCATGCAGCTGCGCCGGCCACCCCGACTCCC
CCGCGCGCGACCGAGGCTCAGCCCAGTGGCGGAAATGCCTCGGGCTTGGCCATGGGCGACGAACGTACCGAGGCG
ATTGCCAATATGGAAGCCATGGGGTTCGAGAGGCCTCATATAGAGGCTGCCATGCGCGCTGCCTTCAACAACCCC
GACCGTGCCGTCGAGTATCTACTGAATGGAATTCCGGACAACGTTCAACAGGAGCAACAGCAGCGCCGCGCTCCC
GCTGCTGCGTCCACCGGTGCGTCCGCGCAGTCTGCTCCACCGGCGCAAAGTGGAGAGGATGACGGAGGCGTGAAC
CTCTTCGACCTCGCTGCCCAACAGGGAGGCGGAGCCGCCCCTCGAGGTTCGGGCATGGGCTCTGCTGCCGCCGCC
GCCGCCGCCGCCGCCCAGGGTGGCGACCTGGGGAATCTGGACTTCCTCCGGCACAATGCACAGTTCCAGCAGCTC
CGCCAAGTCGTCCAGCAACAGCCGCAAATGCTGGAACCCATCCTGCAGCAGCTAGGTGCCGGCAATCCGCAGTTG
GCGCAGCTCATTGCCTCCAACCCCGACCAATTTCTTCAACTACTTGGAGAAAACGCCGACGACGACGTTCCCCTG
CCCCCTGGCGCGCAGGCCATCTCCGTCACCGAGGAGGAGCGAGACGCCATCGAGCGATTATGTCGGCTTGGATTC
GACCGAGATCAGGCCATCCAAGCCTACTTCGCCTGCGACAAGAACGAGGAGCTTGCTGCCAACTTCCTCTTTGAG
CAACCAGAGGACGAGGAGCCCCCCACAAACTAA
Transcript >Hirsu2|7096
ATGAAGGTCACATTTAGGGACTTGAAGCAGCAAAAGTTCACCCTCGAGGTTGAACCGACCGACCAAATCTTGGCG
GTCAAGGAGAAGATTTCAGGCGAAAAGGGCTGGGACCCCAAATACCAGAAGCTCATCTACTCTGGCAAAATTCTC
AAGGATGAGGAAACGGTCGCCTCCTACAACATCGAGGAGAAGGGCTTTGTCGTCTGCATGGTGAACAAGCCCAAG
GAGAAGCCCGCTGCCTCGTCCTCGGCCGCCGAACCCTCGGCCGCTCCTCCAGCAACTCCCGCCCAGCCTGTCGCC
AGCACCCCGGCGCCCCCTGCCGCCCCGTCTCAGTCCTCGTCGGCCCATGCAGCTGCGCCGGCCACCCCGACTCCC
CCGCGCGCGACCGAGGCTCAGCCCAGTGGCGGAAATGCCTCGGGCTTGGCCATGGGCGACGAACGTACCGAGGCG
ATTGCCAATATGGAAGCCATGGGGTTCGAGAGGCCTCATATAGAGGCTGCCATGCGCGCTGCCTTCAACAACCCC
GACCGTGCCGTCGAGTATCTACTGAATGGAATTCCGGACAACGTTCAACAGGAGCAACAGCAGCGCCGCGCTCCC
GCTGCTGCGTCCACCGGTGCGTCCGCGCAGTCTGCTCCACCGGCGCAAAGTGGAGAGGATGACGGAGGCGTGAAC
CTCTTCGACCTCGCTGCCCAACAGGGAGGCGGAGCCGCCCCTCGAGGTTCGGGCATGGGCTCTGCTGCCGCCGCC
GCCGCCGCCGCCGCCCAGGGTGGCGACCTGGGGAATCTGGACTTCCTCCGGCACAATGCACAGTTCCAGCAGCTC
CGCCAAGTCGTCCAGCAACAGCCGCAAATGCTGGAACCCATCCTGCAGCAGCTAGGTGCCGGCAATCCGCAGTTG
GCGCAGCTCATTGCCTCCAACCCCGACCAATTTCTTCAACTACTTGGAGAAAACGCCGACGACGACGTTCCCCTG
CCCCCTGGCGCGCAGGCCATCTCCGTCACCGAGGAGGAGCGAGACGCCATCGAGCGATTATGTCGGCTTGGATTC
GACCGAGATCAGGCCATCCAAGCCTACTTCGCCTGCGACAAGAACGAGGAGCTTGCTGCCAACTTCCTCTTTGAG
CAACCAGAGGACGAGGAGCCCCCCACAAACTAA
Gene >Hirsu2|7096
ATGAAGGTCACATTTAGGGTATGCGCTGCCGTCTCCATCGCCGGCGACAGAGGGCTGACCTTCCGCCCCTCGATA
GGACTTGAAGCAGCAAAAGTTCACCCTCGAGGTTGAACCGACCGACCAAGTAAGCCCGCCTGCTGCCTACATCGT
CCTGTCCATGACCCGACCGACCTGCCCTCAACAGACGTGTCCTCCTCCGGACTGCCTTCACTGACCCTCCACTGA
CCCTCCACTGACCTTCTCGAGCCGCTGCTCGAGCTCACTTGCCTTGTGCTGACCGTCCTGCCCCCCCGAAACAGA
TCTTGGCGGTCAAGGAGAAGATTTCAGGCGAAAAGGGCTGGGACCCCAAATACCAGAAGCTCATCTACTCTGGTA
AGGCGCGAAACCGATTCCCGTCCGTCCCCTCCCCGGCTGATCACCTGCGACAGGCAAAATTCTCAAGGATGAGGA
AACGGTCGCCTCCTACAACATCGAGGAGAAGGGCTTTGTCGTCTGCATGGTGAACAAGGTGCGACCATCCCTTAC
CCTGAACCCGGGGATTCCGAGAACTAACTTCTCCTCGCTGTCAGCCCAAGGAGAAGCCCGCTGCCTCGTCCTCGG
CCGCCGAACCCTCGGCCGCTCCTCCAGCAACTCCCGCCCAGCCTGTCGCCAGCACCCCGGCGCCCCCTGCCGCCC
CGTCTCAGTCCTCGTCGGCCCATGCAGCTGCGCCGGCCACCCCGACTCCCCCGCGCGCGACCGAGGCTCAGCCCA
GTGGCGGAAATGCCTCGGGCTTGGCCATGGGCGACGAACGTACCGAGGCGATTGCCAATATGGAAGCCATGGGGT
TCGAGAGGCCTCATATAGAGGCTGCCATGCGCGCTGCCTTCAACAACCCCGACCGTGCCGTCGAGTATCTACTGA
ATGTCCGTCTGCTCGCCAATTGTGCCGTCCTGGCTGACGTGCGACTGACTCTGCTTGATTAGGGAATTCCGGACA
ACGTTCAACAGGAGCAACAGCAGCGCCGCGCTCCCGCTGCTGCGTCCACCGGTGCGTCCGCGCAGTCTGCTCCAC
CGGCGCAAAGTGGAGAGGATGACGGAGGCGTGAACCTCTTCGACCTCGCTGCCCAACAGGGAGGCGGAGCCGCCC
CTCGAGGTTCGGGCATGGGCTCTGCTGCCGCCGCCGCCGCCGCCGCCGCCCAGGGTGGCGACCTGGGGAATCTGG
ACTTCCTCCGGCACAATGCACAGTTCCAGCAGCTCCGCCAAGTCGTCCAGCAACAGCCGCAAATGCTGGAACCCA
TCCTGCAGCAGCTAGGTGCCGGCAATCCGCAGTTGGCGCAGCTCATTGCCTCCAACCCCGACCAATTTCTTCAAC
TACTTGGAGAAAACGCCGACGACGACGTTCCCCTGCCCCCTGGCGCGCAGGCCATCTCCGTCACCGAGGAGGAGC
GAGACGCCATCGAGCGAGTACGTGCATCGCGTGTCCCCCAAGCAATGAAAGAAGCAAGGCTCGGCTAACAGACAG
CAGTTATGTCGGCTTGGATTCGACCGAGATCAGGCCATCCAAGCCTACTTCGCCTGCGACAAGAACGAGGAGCTT
GCTGCCAACTTCCTCTTTGAGCAACCAGAGGACGAGGAGCCCCCCACAAACTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail