Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|7095
Gene name
LocationContig_397:5890..6736
Strand+
Gene length (bp)846
Transcript length (bp)846
Coding sequence length (bp)846
Protein length (aa) 282

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF15963 Myb_DNA-bind_7 Myb DNA-binding like 1.2E-25 128 204
PF00249 Myb_DNA-binding Myb-like DNA-binding domain 2.1E-06 132 171

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O94481|TFC5_SCHPO Transcription factor TFIIIB component B'' OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=bdp1 PE=3 SV=2 59 219 3.0E-31
sp|P46678|TFC5_YEAST Transcription factor TFIIIB component B'' OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BDP1 PE=1 SV=1 76 198 4.0E-15
sp|Q571C7|BDP1_MOUSE Transcription factor TFIIIB component B'' homolog OS=Mus musculus GN=Bdp1 PE=2 SV=2 70 185 1.0E-11
sp|A6H8Y1|BDP1_HUMAN Transcription factor TFIIIB component B'' homolog OS=Homo sapiens GN=BDP1 PE=1 SV=3 70 185 2.0E-11

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 38 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|7095
MADLTKDLRIGKKFSRHDELRDRERQARAKAKLQKDGDQTDGAASASASPKPDGPTASGSRNDPDAPAGPQFRIV
DGQIVVDQNSLVMDRHARAAAAQARDDMETVEENDFTRLITSSSYMTSSKLKGPNIWTDEETELFYRGLRMFGTE
FEMISKMFPGKQRRHIKLKFNREERHNPKRIDAALIGEKTIKMDIDEYRAFTGAEFESVETIEAEQRKIEESYEE
ERQRIADEQAEMMRKKREELFADDRDDGKRKRGGKKKGKRPTVAYGLNGEPIAQDG*
Coding >Hirsu2|7095
ATGGCCGATTTGACAAAGGATCTGCGGATCGGCAAAAAGTTCAGTCGGCACGACGAGCTACGAGACCGAGAAAGG
CAGGCTCGGGCCAAGGCCAAGCTTCAAAAGGACGGAGACCAGACAGACGGCGCAGCCTCCGCCTCCGCCTCGCCC
AAGCCAGACGGCCCGACCGCATCGGGGAGCCGGAACGACCCCGACGCGCCAGCAGGCCCGCAGTTTCGCATCGTG
GACGGACAGATTGTAGTCGACCAGAACTCGCTCGTCATGGACCGCCACGCGCGCGCGGCCGCGGCACAGGCCAGG
GACGACATGGAGACGGTGGAGGAAAACGACTTCACGAGGCTGATCACCAGCAGCTCCTACATGACCTCTTCCAAG
CTCAAGGGCCCAAACATATGGACGGACGAGGAGACGGAGCTCTTTTACCGCGGACTTAGAATGTTCGGGACCGAG
TTCGAGATGATCTCCAAGATGTTCCCGGGCAAGCAGCGGCGGCACATCAAGCTCAAGTTCAACCGCGAGGAGCGG
CATAACCCGAAGCGCATCGACGCGGCCCTCATCGGCGAGAAGACGATCAAGATGGACATCGACGAGTACCGGGCC
TTCACCGGCGCCGAGTTCGAGTCGGTCGAGACGATCGAGGCGGAGCAGCGCAAGATCGAGGAGAGCTACGAGGAG
GAGCGGCAGCGCATCGCCGACGAGCAGGCCGAGATGATGCGCAAGAAGCGCGAGGAGCTCTTCGCCGACGACCGC
GACGACGGCAAGCGGAAGCGCGGCGGCAAGAAAAAGGGCAAGCGTCCGACGGTTGCCTACGGGCTCAACGGGGAG
CCCATCGCGCAAGACGGATGA
Transcript >Hirsu2|7095
ATGGCCGATTTGACAAAGGATCTGCGGATCGGCAAAAAGTTCAGTCGGCACGACGAGCTACGAGACCGAGAAAGG
CAGGCTCGGGCCAAGGCCAAGCTTCAAAAGGACGGAGACCAGACAGACGGCGCAGCCTCCGCCTCCGCCTCGCCC
AAGCCAGACGGCCCGACCGCATCGGGGAGCCGGAACGACCCCGACGCGCCAGCAGGCCCGCAGTTTCGCATCGTG
GACGGACAGATTGTAGTCGACCAGAACTCGCTCGTCATGGACCGCCACGCGCGCGCGGCCGCGGCACAGGCCAGG
GACGACATGGAGACGGTGGAGGAAAACGACTTCACGAGGCTGATCACCAGCAGCTCCTACATGACCTCTTCCAAG
CTCAAGGGCCCAAACATATGGACGGACGAGGAGACGGAGCTCTTTTACCGCGGACTTAGAATGTTCGGGACCGAG
TTCGAGATGATCTCCAAGATGTTCCCGGGCAAGCAGCGGCGGCACATCAAGCTCAAGTTCAACCGCGAGGAGCGG
CATAACCCGAAGCGCATCGACGCGGCCCTCATCGGCGAGAAGACGATCAAGATGGACATCGACGAGTACCGGGCC
TTCACCGGCGCCGAGTTCGAGTCGGTCGAGACGATCGAGGCGGAGCAGCGCAAGATCGAGGAGAGCTACGAGGAG
GAGCGGCAGCGCATCGCCGACGAGCAGGCCGAGATGATGCGCAAGAAGCGCGAGGAGCTCTTCGCCGACGACCGC
GACGACGGCAAGCGGAAGCGCGGCGGCAAGAAAAAGGGCAAGCGTCCGACGGTTGCCTACGGGCTCAACGGGGAG
CCCATCGCGCAAGACGGATGA
Gene >Hirsu2|7095
ATGGCCGATTTGACAAAGGATCTGCGGATCGGCAAAAAGTTCAGTCGGCACGACGAGCTACGAGACCGAGAAAGG
CAGGCTCGGGCCAAGGCCAAGCTTCAAAAGGACGGAGACCAGACAGACGGCGCAGCCTCCGCCTCCGCCTCGCCC
AAGCCAGACGGCCCGACCGCATCGGGGAGCCGGAACGACCCCGACGCGCCAGCAGGCCCGCAGTTTCGCATCGTG
GACGGACAGATTGTAGTCGACCAGAACTCGCTCGTCATGGACCGCCACGCGCGCGCGGCCGCGGCACAGGCCAGG
GACGACATGGAGACGGTGGAGGAAAACGACTTCACGAGGCTGATCACCAGCAGCTCCTACATGACCTCTTCCAAG
CTCAAGGGCCCAAACATATGGACGGACGAGGAGACGGAGCTCTTTTACCGCGGACTTAGAATGTTCGGGACCGAG
TTCGAGATGATCTCCAAGATGTTCCCGGGCAAGCAGCGGCGGCACATCAAGCTCAAGTTCAACCGCGAGGAGCGG
CATAACCCGAAGCGCATCGACGCGGCCCTCATCGGCGAGAAGACGATCAAGATGGACATCGACGAGTACCGGGCC
TTCACCGGCGCCGAGTTCGAGTCGGTCGAGACGATCGAGGCGGAGCAGCGCAAGATCGAGGAGAGCTACGAGGAG
GAGCGGCAGCGCATCGCCGACGAGCAGGCCGAGATGATGCGCAAGAAGCGCGAGGAGCTCTTCGCCGACGACCGC
GACGACGGCAAGCGGAAGCGCGGCGGCAAGAAAAAGGGCAAGCGTCCGACGGTTGCCTACGGGCTCAACGGGGAG
CCCATCGCGCAAGACGGATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail