Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|7093
Gene name
LocationContig_397:343..1288
Strand+
Gene length (bp)945
Transcript length (bp)945
Coding sequence length (bp)945
Protein length (aa) 315

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF06682 SARAF SOCE-associated regulatory factor of calcium homoeostasis 3.3E-105 13 314

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q0IHF9|SARAF_XENLA Store-operated calcium entry-associated regulatory factor OS=Xenopus laevis GN=saraf PE=2 SV=2 10 314 2.0E-31
sp|Q6AYN2|SARAF_RAT Store-operated calcium entry-associated regulatory factor OS=Rattus norvegicus GN=Saraf PE=2 SV=1 17 258 5.0E-26
sp|Q8R3Q0|SARAF_MOUSE Store-operated calcium entry-associated regulatory factor OS=Mus musculus GN=Saraf PE=1 SV=2 17 258 4.0E-25
sp|Q08E24|SARAF_BOVIN Store-operated calcium entry-associated regulatory factor OS=Bos taurus GN=SARAF PE=2 SV=1 23 314 5.0E-25
sp|F1QPC3|SARAF_DANRE Store-operated calcium entry-associated regulatory factor OS=Danio rerio GN=saraf PE=2 SV=1 25 137 2.0E-24
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q0IHF9|SARAF_XENLA Store-operated calcium entry-associated regulatory factor OS=Xenopus laevis GN=saraf PE=2 SV=2 10 314 2.0E-31
sp|Q6AYN2|SARAF_RAT Store-operated calcium entry-associated regulatory factor OS=Rattus norvegicus GN=Saraf PE=2 SV=1 17 258 5.0E-26
sp|Q8R3Q0|SARAF_MOUSE Store-operated calcium entry-associated regulatory factor OS=Mus musculus GN=Saraf PE=1 SV=2 17 258 4.0E-25
sp|Q08E24|SARAF_BOVIN Store-operated calcium entry-associated regulatory factor OS=Bos taurus GN=SARAF PE=2 SV=1 23 314 5.0E-25
sp|F1QPC3|SARAF_DANRE Store-operated calcium entry-associated regulatory factor OS=Danio rerio GN=saraf PE=2 SV=1 25 137 2.0E-24
sp|Q96BY9|SARAF_HUMAN Store-operated calcium entry-associated regulatory factor OS=Homo sapiens GN=SARAF PE=1 SV=1 17 176 3.0E-24
sp|Q5R491|SARAF_PONAB Store-operated calcium entry-associated regulatory factor OS=Pongo abelii GN=SARAF PE=2 SV=2 17 176 3.0E-24
sp|Q54P59|SARAF_DICDI Store-operated calcium entry-associated regulatory factor OS=Dictyostelium discoideum GN=saraf PE=3 SV=1 26 204 3.0E-24
sp|F7C1E2|SARAF_XENTR Store-operated calcium entry-associated regulatory factor OS=Xenopus tropicalis GN=saraf PE=3 SV=2 23 137 7.0E-23
[Show less]

GO

GO Term Description Terminal node
GO:0030176 integral component of endoplasmic reticulum membrane Yes
GO:2001256 regulation of store-operated calcium entry Yes
GO:0044446 intracellular organelle part No
GO:0044424 intracellular part No
GO:0016021 integral component of membrane No
GO:0044432 endoplasmic reticulum part No
GO:0050789 regulation of biological process No
GO:0044444 cytoplasmic part No
GO:0044464 cell part No
GO:0044425 membrane part No
GO:0031224 intrinsic component of membrane No
GO:0031227 intrinsic component of endoplasmic reticulum membrane No
GO:0065007 biological regulation No
GO:0032879 regulation of localization No
GO:0043269 regulation of ion transport No
GO:0008150 biological_process No
GO:0010959 regulation of metal ion transport No
GO:0051924 regulation of calcium ion transport No
GO:0044422 organelle part No
GO:0051049 regulation of transport No
GO:0005575 cellular_component No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 20 0.45

Transmembrane Domains

Domain # Start End Length
1 158 180 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|7093
MLAHLIALPLALLPPLALAARPKNAILLSDVQTLTLRGHGAKTSHRRLGPIPQLKCVSSKDVCKLYDIDVMRCTN
QGSSYGGEDVEWSCTASLPEELKLGSTDVICEGYSSPDDPYVLKGSCGVEYRMVLTPKGEARYPSLAKSYAGFFT
DEYGATDWSAWLFTLIFVAVLGWILYSACFGNNGNARPRTAGGRRGGGGGGGGGGGGGGWWNPGWGPGDDPPPPY
PGTKPYSTQSQGWRPGFWSGVLGGAAAGYMAGNRNQADGRQRAYPSNWGSSWDGPGPSGSRRYSPPPSAFGGQGS
ARHESTGFGSTRRR*
Coding >Hirsu2|7093
ATGCTCGCCCACCTCATCGCCCTCCCCCTCGCCCTCCTCCCCCCGTTGGCGCTCGCCGCGCGGCCCAAGAACGCC
ATCCTCCTGTCCGACGTCCAGACGCTCACGCTGCGCGGCCATGGCGCCAAGACGAGCCACCGCCGCCTCGGCCCC
ATCCCCCAGCTCAAGTGCGTCTCGTCCAAGGACGTCTGCAAGCTCTACGACATCGACGTCATGCGCTGCACCAAC
CAGGGCTCCTCCTATGGCGGCGAGGACGTCGAGTGGAGCTGCACCGCCTCGCTGCCCGAGGAGCTCAAGCTCGGC
AGCACCGACGTCATCTGCGAGGGATACTCCTCCCCTGACGACCCCTATGTCCTCAAGGGCAGCTGCGGCGTCGAG
TATCGCATGGTCCTGACGCCCAAGGGCGAGGCAAGGTATCCCAGCCTGGCCAAGTCGTACGCCGGCTTCTTCACC
GACGAGTACGGCGCCACCGACTGGTCCGCCTGGCTCTTCACCCTCATCTTCGTCGCCGTTCTCGGCTGGATTCTC
TACTCGGCCTGCTTTGGCAACAATGGCAACGCACGGCCACGCACAGCCGGAGGACGCCGTGGCGGCGGCGGGGGA
GGAGGAGGAGGTGGTGGTGGTGGTGGGTGGTGGAATCCCGGCTGGGGGCCCGGTGACGATCCTCCGCCCCCCTAT
CCGGGAACCAAGCCTTACTCGACACAGTCGCAGGGCTGGAGGCCGGGCTTCTGGTCTGGCGTCCTCGGCGGTGCC
GCCGCCGGCTACATGGCCGGCAATCGCAACCAGGCCGACGGCAGGCAACGCGCCTATCCGAGCAATTGGGGCAGC
AGTTGGGATGGTCCAGGGCCCTCCGGCTCCCGACGCTACTCCCCGCCGCCGTCGGCCTTCGGTGGCCAAGGCTCG
GCCCGTCACGAAAGCACAGGCTTTGGTTCTACCCGTCGTAGATAG
Transcript >Hirsu2|7093
ATGCTCGCCCACCTCATCGCCCTCCCCCTCGCCCTCCTCCCCCCGTTGGCGCTCGCCGCGCGGCCCAAGAACGCC
ATCCTCCTGTCCGACGTCCAGACGCTCACGCTGCGCGGCCATGGCGCCAAGACGAGCCACCGCCGCCTCGGCCCC
ATCCCCCAGCTCAAGTGCGTCTCGTCCAAGGACGTCTGCAAGCTCTACGACATCGACGTCATGCGCTGCACCAAC
CAGGGCTCCTCCTATGGCGGCGAGGACGTCGAGTGGAGCTGCACCGCCTCGCTGCCCGAGGAGCTCAAGCTCGGC
AGCACCGACGTCATCTGCGAGGGATACTCCTCCCCTGACGACCCCTATGTCCTCAAGGGCAGCTGCGGCGTCGAG
TATCGCATGGTCCTGACGCCCAAGGGCGAGGCAAGGTATCCCAGCCTGGCCAAGTCGTACGCCGGCTTCTTCACC
GACGAGTACGGCGCCACCGACTGGTCCGCCTGGCTCTTCACCCTCATCTTCGTCGCCGTTCTCGGCTGGATTCTC
TACTCGGCCTGCTTTGGCAACAATGGCAACGCACGGCCACGCACAGCCGGAGGACGCCGTGGCGGCGGCGGGGGA
GGAGGAGGAGGTGGTGGTGGTGGTGGGTGGTGGAATCCCGGCTGGGGGCCCGGTGACGATCCTCCGCCCCCCTAT
CCGGGAACCAAGCCTTACTCGACACAGTCGCAGGGCTGGAGGCCGGGCTTCTGGTCTGGCGTCCTCGGCGGTGCC
GCCGCCGGCTACATGGCCGGCAATCGCAACCAGGCCGACGGCAGGCAACGCGCCTATCCGAGCAATTGGGGCAGC
AGTTGGGATGGTCCAGGGCCCTCCGGCTCCCGACGCTACTCCCCGCCGCCGTCGGCCTTCGGTGGCCAAGGCTCG
GCCCGTCACGAAAGCACAGGCTTTGGTTCTACCCGTCGTAGATAG
Gene >Hirsu2|7093
ATGCTCGCCCACCTCATCGCCCTCCCCCTCGCCCTCCTCCCCCCGTTGGCGCTCGCCGCGCGGCCCAAGAACGCC
ATCCTCCTGTCCGACGTCCAGACGCTCACGCTGCGCGGCCATGGCGCCAAGACGAGCCACCGCCGCCTCGGCCCC
ATCCCCCAGCTCAAGTGCGTCTCGTCCAAGGACGTCTGCAAGCTCTACGACATCGACGTCATGCGCTGCACCAAC
CAGGGCTCCTCCTATGGCGGCGAGGACGTCGAGTGGAGCTGCACCGCCTCGCTGCCCGAGGAGCTCAAGCTCGGC
AGCACCGACGTCATCTGCGAGGGATACTCCTCCCCTGACGACCCCTATGTCCTCAAGGGCAGCTGCGGCGTCGAG
TATCGCATGGTCCTGACGCCCAAGGGCGAGGCAAGGTATCCCAGCCTGGCCAAGTCGTACGCCGGCTTCTTCACC
GACGAGTACGGCGCCACCGACTGGTCCGCCTGGCTCTTCACCCTCATCTTCGTCGCCGTTCTCGGCTGGATTCTC
TACTCGGCCTGCTTTGGCAACAATGGCAACGCACGGCCACGCACAGCCGGAGGACGCCGTGGCGGCGGCGGGGGA
GGAGGAGGAGGTGGTGGTGGTGGTGGGTGGTGGAATCCCGGCTGGGGGCCCGGTGACGATCCTCCGCCCCCCTAT
CCGGGAACCAAGCCTTACTCGACACAGTCGCAGGGCTGGAGGCCGGGCTTCTGGTCTGGCGTCCTCGGCGGTGCC
GCCGCCGGCTACATGGCCGGCAATCGCAACCAGGCCGACGGCAGGCAACGCGCCTATCCGAGCAATTGGGGCAGC
AGTTGGGATGGTCCAGGGCCCTCCGGCTCCCGACGCTACTCCCCGCCGCCGTCGGCCTTCGGTGGCCAAGGCTCG
GCCCGTCACGAAAGCACAGGCTTTGGTTCTACCCGTCGTAGATAG

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail