Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|709
Gene name
LocationContig_1144:923..2828
Strand-
Gene length (bp)1905
Transcript length (bp)1905
Coding sequence length (bp)1905
Protein length (aa) 635

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12697 Abhydrolase_6 Alpha/beta hydrolase family 2.9E-14 66 290
PF00561 Abhydrolase_1 alpha/beta hydrolase fold 5.6E-13 64 300
PF12146 Hydrolase_4 Serine aminopeptidase, S33 4.2E-09 65 205
PF00975 Thioesterase Thioesterase domain 8.0E-07 66 155

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O55236|MCE1_MOUSE mRNA-capping enzyme OS=Mus musculus GN=Rngtt PE=1 SV=1 494 631 2.0E-14
sp|O60942|MCE1_HUMAN mRNA-capping enzyme OS=Homo sapiens GN=RNGTT PE=1 SV=1 507 631 4.0E-14
sp|P87056|YDJ8_SCHPO Abhydrolase domain-containing protein C57A10.08c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC57A10.08c PE=3 SV=2 65 275 5.0E-11
sp|Q17607|MCE1_CAEEL mRNA-capping enzyme OS=Caenorhabditis elegans GN=cel-1 PE=1 SV=2 508 632 1.0E-10
sp|P24656|PTP_NPVAC Tyrosine-protein phosphatase OS=Autographa californica nuclear polyhedrosis virus GN=PTP PE=1 SV=2 507 629 2.0E-10
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O55236|MCE1_MOUSE mRNA-capping enzyme OS=Mus musculus GN=Rngtt PE=1 SV=1 494 631 2.0E-14
sp|O60942|MCE1_HUMAN mRNA-capping enzyme OS=Homo sapiens GN=RNGTT PE=1 SV=1 507 631 4.0E-14
sp|P87056|YDJ8_SCHPO Abhydrolase domain-containing protein C57A10.08c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC57A10.08c PE=3 SV=2 65 275 5.0E-11
sp|Q17607|MCE1_CAEEL mRNA-capping enzyme OS=Caenorhabditis elegans GN=cel-1 PE=1 SV=2 508 632 1.0E-10
sp|P24656|PTP_NPVAC Tyrosine-protein phosphatase OS=Autographa californica nuclear polyhedrosis virus GN=PTP PE=1 SV=2 507 629 2.0E-10
sp|Q6NY98|MCE1_DANRE mRNA-capping enzyme OS=Danio rerio GN=rngtt PE=2 SV=1 507 631 1.0E-09
sp|O10274|PTP1_NPVOP Putative tyrosine-protein phosphatase 1 OS=Orgyia pseudotsugata multicapsid polyhedrosis virus GN=PTP-1 PE=3 SV=1 507 634 4.0E-08
sp|P34442|PTP5_CAEEL Probable tyrosine-protein phosphatase F54C8.4 OS=Caenorhabditis elegans GN=F54C8.4 PE=3 SV=1 460 628 6.0E-07
sp|Q9BVJ7|DUS23_HUMAN Dual specificity protein phosphatase 23 OS=Homo sapiens GN=DUSP23 PE=1 SV=1 526 618 8.0E-07
sp|Q6NT99|DUS23_MOUSE Dual specificity protein phosphatase 23 OS=Mus musculus GN=Dusp23 PE=1 SV=1 526 618 2.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0009058 biosynthetic process Yes
GO:0008152 metabolic process No
GO:0008150 biological_process No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm 0.5747 0.4073 0.3028 0.1561 0.3461 0.049 0.3475 0.4258 0.1865 0.012

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup5552
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2171
Ophiocordyceps australis map64 (Brazil) OphauB2|5143
Ophiocordyceps camponoti-floridani Ophcf2|01766
Ophiocordyceps camponoti-rufipedis Ophun1|1004
Ophiocordyceps kimflemingae Ophio5|4967
Ophiocordyceps subramaniannii Hirsu2|709 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|709
MAGPRDSQAASGVVNSTDPHLTDPPLLREHSDFKTYRTNRFCYPGLRVFYRPHAKTKELPNPLPLLVCIPGLGGS
VAQFHPLLSSLVDLAPCLAIDYPGGGRSDYAVTSWDAYTSQALLELLELIIDDYRDKDAGQSVVLIGHSMGTALA
AGLASDKLPHATSLADHVVGLVAICPISEPWDQSVTTILRRLLWIPGWMFALWRAWDGTGGADSPSVARFVGRDA
EPELRILQHRFNRQSRTPVWRRMAYGALPVYADGKPFGGIPGLDVWASLDIPVYLIAGEKDHLTPAGEVDKIAKV
LRLGSPESSEEADGRVGVKAAQGAAVRVGLSSEPQDDASCDFDGPGKDGSGGKTAHRGDGNGDDAQEDPSTPLES
DSFAAAALSMILPPQLEHPFKVVQSTIMPAPANHALLYMPRSARALAGFVSDFLAAHVTQRLSLAWQLRYLSREG
KWDVKNLNKWKSVNPVSDVIGPEGQPIFRAMKTLREADDVHCPASFVEKWGAVVKDVIDISKDQPVYDPRGLERG
GVHYHKFPTVSKVPPEAHEVEGFIDLVDRMRDAQTERATAEAWENARECVIGVHCHYGFNRTGYFIVCYLVERCG
FAIPAAIDAFAKARPNGIRHSHFLDRLYVRYNTR*
Coding >Hirsu2|709
ATGGCAGGCCCTCGCGACTCACAAGCGGCCTCTGGGGTCGTGAATTCCACCGACCCTCACCTCACTGATCCTCCG
CTGCTCAGAGAGCACTCCGACTTCAAGACGTACAGGACCAACCGCTTCTGCTACCCCGGCCTGCGCGTCTTCTAC
CGGCCCCATGCCAAGACTAAGGAGCTTCCGAACCCGCTGCCGCTGCTGGTCTGCATCCCTGGCCTCGGCGGCTCC
GTCGCCCAGTTCCATCCCCTGCTGAGCAGCCTCGTCGACCTGGCGCCCTGTCTGGCCATCGACTATCCAGGCGGC
GGCCGGTCCGACTATGCCGTCACCTCCTGGGACGCCTACACCTCTCAGGCTCTGCTCGAGCTGCTCGAGCTCATC
ATCGACGACTACCGTGACAAGGATGCGGGGCAGAGCGTCGTCCTCATCGGCCACAGCATGGGCACCGCTCTGGCC
GCCGGGCTCGCCAGCGACAAGCTTCCGCATGCCACGTCCCTCGCGGACCACGTCGTCGGCCTCGTCGCCATCTGC
CCCATATCGGAGCCTTGGGATCAGTCAGTCACCACCATCTTGCGGAGACTGCTATGGATCCCGGGCTGGATGTTC
GCCCTATGGCGGGCCTGGGATGGCACGGGCGGCGCGGACAGTCCCAGTGTCGCCCGCTTCGTCGGACGAGACGCG
GAACCCGAATTAAGGATCCTCCAGCATCGCTTCAATCGCCAGAGCCGCACGCCCGTGTGGAGACGCATGGCCTAC
GGCGCCCTACCCGTCTATGCGGACGGCAAGCCCTTCGGAGGCATTCCGGGCCTGGATGTCTGGGCGAGTCTCGAT
ATCCCCGTCTATCTAATTGCCGGCGAGAAGGACCACTTGACGCCCGCAGGCGAGGTGGACAAGATCGCCAAGGTT
CTGCGTCTTGGCAGCCCTGAGTCGTCAGAGGAGGCTGACGGACGGGTTGGGGTCAAGGCGGCTCAGGGCGCCGCC
GTCCGGGTCGGCTTGTCGTCTGAGCCGCAAGATGACGCGTCTTGCGACTTCGACGGTCCCGGGAAAGACGGTTCT
GGTGGAAAGACGGCCCACCGTGGAGACGGCAACGGAGACGATGCGCAAGAGGATCCATCGACTCCTCTCGAGTCC
GACTCCTTCGCCGCCGCCGCGCTGTCCATGATATTGCCTCCCCAACTAGAGCATCCTTTCAAGGTGGTTCAGTCG
ACCATCATGCCGGCGCCGGCGAACCACGCGCTGCTCTACATGCCACGCTCTGCTCGTGCTCTAGCTGGTTTCGTC
TCCGACTTCCTGGCGGCGCACGTGACGCAGCGACTCTCGCTCGCCTGGCAGCTGCGATATCTTTCACGCGAGGGC
AAGTGGGACGTCAAGAACCTCAACAAATGGAAATCCGTCAATCCCGTCTCGGACGTCATTGGCCCCGAGGGCCAG
CCCATCTTCCGGGCCATGAAGACGTTGCGTGAGGCCGACGACGTGCACTGCCCCGCATCCTTCGTCGAGAAATGG
GGCGCCGTCGTCAAGGACGTCATCGACATCTCCAAGGACCAACCCGTCTACGACCCGCGAGGCCTCGAGCGTGGA
GGGGTGCATTACCATAAATTTCCAACCGTATCCAAGGTTCCTCCGGAAGCGCACGAGGTCGAGGGTTTCATCGAC
CTCGTCGACCGGATGCGAGACGCCCAGACAGAGCGGGCCACGGCTGAGGCATGGGAGAACGCCCGGGAATGCGTT
ATCGGCGTACACTGCCACTATGGCTTCAACCGCACCGGCTACTTCATCGTCTGCTACCTTGTGGAGCGATGCGGA
TTCGCCATTCCCGCGGCGATCGATGCCTTTGCTAAGGCGAGGCCCAACGGCATACGCCACTCGCACTTTCTGGAC
CGCCTGTATGTGCGGTATAACACTCGGTGA
Transcript >Hirsu2|709
ATGGCAGGCCCTCGCGACTCACAAGCGGCCTCTGGGGTCGTGAATTCCACCGACCCTCACCTCACTGATCCTCCG
CTGCTCAGAGAGCACTCCGACTTCAAGACGTACAGGACCAACCGCTTCTGCTACCCCGGCCTGCGCGTCTTCTAC
CGGCCCCATGCCAAGACTAAGGAGCTTCCGAACCCGCTGCCGCTGCTGGTCTGCATCCCTGGCCTCGGCGGCTCC
GTCGCCCAGTTCCATCCCCTGCTGAGCAGCCTCGTCGACCTGGCGCCCTGTCTGGCCATCGACTATCCAGGCGGC
GGCCGGTCCGACTATGCCGTCACCTCCTGGGACGCCTACACCTCTCAGGCTCTGCTCGAGCTGCTCGAGCTCATC
ATCGACGACTACCGTGACAAGGATGCGGGGCAGAGCGTCGTCCTCATCGGCCACAGCATGGGCACCGCTCTGGCC
GCCGGGCTCGCCAGCGACAAGCTTCCGCATGCCACGTCCCTCGCGGACCACGTCGTCGGCCTCGTCGCCATCTGC
CCCATATCGGAGCCTTGGGATCAGTCAGTCACCACCATCTTGCGGAGACTGCTATGGATCCCGGGCTGGATGTTC
GCCCTATGGCGGGCCTGGGATGGCACGGGCGGCGCGGACAGTCCCAGTGTCGCCCGCTTCGTCGGACGAGACGCG
GAACCCGAATTAAGGATCCTCCAGCATCGCTTCAATCGCCAGAGCCGCACGCCCGTGTGGAGACGCATGGCCTAC
GGCGCCCTACCCGTCTATGCGGACGGCAAGCCCTTCGGAGGCATTCCGGGCCTGGATGTCTGGGCGAGTCTCGAT
ATCCCCGTCTATCTAATTGCCGGCGAGAAGGACCACTTGACGCCCGCAGGCGAGGTGGACAAGATCGCCAAGGTT
CTGCGTCTTGGCAGCCCTGAGTCGTCAGAGGAGGCTGACGGACGGGTTGGGGTCAAGGCGGCTCAGGGCGCCGCC
GTCCGGGTCGGCTTGTCGTCTGAGCCGCAAGATGACGCGTCTTGCGACTTCGACGGTCCCGGGAAAGACGGTTCT
GGTGGAAAGACGGCCCACCGTGGAGACGGCAACGGAGACGATGCGCAAGAGGATCCATCGACTCCTCTCGAGTCC
GACTCCTTCGCCGCCGCCGCGCTGTCCATGATATTGCCTCCCCAACTAGAGCATCCTTTCAAGGTGGTTCAGTCG
ACCATCATGCCGGCGCCGGCGAACCACGCGCTGCTCTACATGCCACGCTCTGCTCGTGCTCTAGCTGGTTTCGTC
TCCGACTTCCTGGCGGCGCACGTGACGCAGCGACTCTCGCTCGCCTGGCAGCTGCGATATCTTTCACGCGAGGGC
AAGTGGGACGTCAAGAACCTCAACAAATGGAAATCCGTCAATCCCGTCTCGGACGTCATTGGCCCCGAGGGCCAG
CCCATCTTCCGGGCCATGAAGACGTTGCGTGAGGCCGACGACGTGCACTGCCCCGCATCCTTCGTCGAGAAATGG
GGCGCCGTCGTCAAGGACGTCATCGACATCTCCAAGGACCAACCCGTCTACGACCCGCGAGGCCTCGAGCGTGGA
GGGGTGCATTACCATAAATTTCCAACCGTATCCAAGGTTCCTCCGGAAGCGCACGAGGTCGAGGGTTTCATCGAC
CTCGTCGACCGGATGCGAGACGCCCAGACAGAGCGGGCCACGGCTGAGGCATGGGAGAACGCCCGGGAATGCGTT
ATCGGCGTACACTGCCACTATGGCTTCAACCGCACCGGCTACTTCATCGTCTGCTACCTTGTGGAGCGATGCGGA
TTCGCCATTCCCGCGGCGATCGATGCCTTTGCTAAGGCGAGGCCCAACGGCATACGCCACTCGCACTTTCTGGAC
CGCCTGTATGTGCGGTATAACACTCGGTGA
Gene >Hirsu2|709
ATGGCAGGCCCTCGCGACTCACAAGCGGCCTCTGGGGTCGTGAATTCCACCGACCCTCACCTCACTGATCCTCCG
CTGCTCAGAGAGCACTCCGACTTCAAGACGTACAGGACCAACCGCTTCTGCTACCCCGGCCTGCGCGTCTTCTAC
CGGCCCCATGCCAAGACTAAGGAGCTTCCGAACCCGCTGCCGCTGCTGGTCTGCATCCCTGGCCTCGGCGGCTCC
GTCGCCCAGTTCCATCCCCTGCTGAGCAGCCTCGTCGACCTGGCGCCCTGTCTGGCCATCGACTATCCAGGCGGC
GGCCGGTCCGACTATGCCGTCACCTCCTGGGACGCCTACACCTCTCAGGCTCTGCTCGAGCTGCTCGAGCTCATC
ATCGACGACTACCGTGACAAGGATGCGGGGCAGAGCGTCGTCCTCATCGGCCACAGCATGGGCACCGCTCTGGCC
GCCGGGCTCGCCAGCGACAAGCTTCCGCATGCCACGTCCCTCGCGGACCACGTCGTCGGCCTCGTCGCCATCTGC
CCCATATCGGAGCCTTGGGATCAGTCAGTCACCACCATCTTGCGGAGACTGCTATGGATCCCGGGCTGGATGTTC
GCCCTATGGCGGGCCTGGGATGGCACGGGCGGCGCGGACAGTCCCAGTGTCGCCCGCTTCGTCGGACGAGACGCG
GAACCCGAATTAAGGATCCTCCAGCATCGCTTCAATCGCCAGAGCCGCACGCCCGTGTGGAGACGCATGGCCTAC
GGCGCCCTACCCGTCTATGCGGACGGCAAGCCCTTCGGAGGCATTCCGGGCCTGGATGTCTGGGCGAGTCTCGAT
ATCCCCGTCTATCTAATTGCCGGCGAGAAGGACCACTTGACGCCCGCAGGCGAGGTGGACAAGATCGCCAAGGTT
CTGCGTCTTGGCAGCCCTGAGTCGTCAGAGGAGGCTGACGGACGGGTTGGGGTCAAGGCGGCTCAGGGCGCCGCC
GTCCGGGTCGGCTTGTCGTCTGAGCCGCAAGATGACGCGTCTTGCGACTTCGACGGTCCCGGGAAAGACGGTTCT
GGTGGAAAGACGGCCCACCGTGGAGACGGCAACGGAGACGATGCGCAAGAGGATCCATCGACTCCTCTCGAGTCC
GACTCCTTCGCCGCCGCCGCGCTGTCCATGATATTGCCTCCCCAACTAGAGCATCCTTTCAAGGTGGTTCAGTCG
ACCATCATGCCGGCGCCGGCGAACCACGCGCTGCTCTACATGCCACGCTCTGCTCGTGCTCTAGCTGGTTTCGTC
TCCGACTTCCTGGCGGCGCACGTGACGCAGCGACTCTCGCTCGCCTGGCAGCTGCGATATCTTTCACGCGAGGGC
AAGTGGGACGTCAAGAACCTCAACAAATGGAAATCCGTCAATCCCGTCTCGGACGTCATTGGCCCCGAGGGCCAG
CCCATCTTCCGGGCCATGAAGACGTTGCGTGAGGCCGACGACGTGCACTGCCCCGCATCCTTCGTCGAGAAATGG
GGCGCCGTCGTCAAGGACGTCATCGACATCTCCAAGGACCAACCCGTCTACGACCCGCGAGGCCTCGAGCGTGGA
GGGGTGCATTACCATAAATTTCCAACCGTATCCAAGGTTCCTCCGGAAGCGCACGAGGTCGAGGGTTTCATCGAC
CTCGTCGACCGGATGCGAGACGCCCAGACAGAGCGGGCCACGGCTGAGGCATGGGAGAACGCCCGGGAATGCGTT
ATCGGCGTACACTGCCACTATGGCTTCAACCGCACCGGCTACTTCATCGTCTGCTACCTTGTGGAGCGATGCGGA
TTCGCCATTCCCGCGGCGATCGATGCCTTTGCTAAGGCGAGGCCCAACGGCATACGCCACTCGCACTTTCTGGAC
CGCCTGTATGTGCGGTATAACACTCGGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail