Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|7079
Gene name
LocationContig_394:18793..19505
Strand-
Gene length (bp)712
Transcript length (bp)609
Coding sequence length (bp)609
Protein length (aa) 203

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00472 RF-1 RF-1 domain 1.5E-24 40 137

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9Y811|YONI_SCHPO Uncharacterized peptide chain release factor-like protein C1105.18c, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1105.18c PE=3 SV=2 20 109 3.0E-22
sp|Q05863|YL281_YEAST Uncharacterized peptide chain release factor-like protein YLR281C, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YLR281C PE=1 SV=1 11 100 5.0E-21
sp|A5WUX7|CL065_DANRE Probable peptide chain release factor C12orf65 homolog, mitochondrial OS=Danio rerio GN=si:ch211-275j6.5 PE=3 SV=1 41 139 5.0E-19
sp|Q80VP5|CL065_MOUSE Probable peptide chain release factor C12orf65 homolog, mitochondrial OS=Mus musculus PE=1 SV=1 38 109 8.0E-19
sp|Q9H3J6|CL065_HUMAN Probable peptide chain release factor C12orf65, mitochondrial OS=Homo sapiens GN=C12orf65 PE=2 SV=1 41 109 1.0E-18
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9Y811|YONI_SCHPO Uncharacterized peptide chain release factor-like protein C1105.18c, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1105.18c PE=3 SV=2 20 109 3.0E-22
sp|Q05863|YL281_YEAST Uncharacterized peptide chain release factor-like protein YLR281C, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YLR281C PE=1 SV=1 11 100 5.0E-21
sp|A5WUX7|CL065_DANRE Probable peptide chain release factor C12orf65 homolog, mitochondrial OS=Danio rerio GN=si:ch211-275j6.5 PE=3 SV=1 41 139 5.0E-19
sp|Q80VP5|CL065_MOUSE Probable peptide chain release factor C12orf65 homolog, mitochondrial OS=Mus musculus PE=1 SV=1 38 109 8.0E-19
sp|Q9H3J6|CL065_HUMAN Probable peptide chain release factor C12orf65, mitochondrial OS=Homo sapiens GN=C12orf65 PE=2 SV=1 41 109 1.0E-18
sp|Q03VA1|RF1_LEUMM Peptide chain release factor 1 OS=Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / NCDO 523) GN=prfA PE=3 SV=1 41 116 2.0E-14
sp|B1MVN7|RF1_LEUCK Peptide chain release factor 1 OS=Leuconostoc citreum (strain KM20) GN=prfA PE=3 SV=1 41 111 8.0E-14
sp|B8HBH8|RF2_ARTCA Peptide chain release factor 2 OS=Arthrobacter chlorophenolicus (strain ATCC 700700 / DSM 12829 / JCM 12360 / NCIMB 13794 / A6) GN=prfB PE=3 SV=1 40 123 3.0E-13
sp|C5BYB6|RF2_BEUC1 Peptide chain release factor 2 OS=Beutenbergia cavernae (strain ATCC BAA-8 / DSM 12333 / NBRC 16432) GN=prfB PE=3 SV=1 40 123 4.0E-13
sp|Q1GAX5|RF1_LACDA Peptide chain release factor 1 OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081 / JCM 1002 / NBRC 13953 / NCIMB 11778) GN=prfA PE=3 SV=1 43 107 6.0E-13
sp|Q04BB3|RF1_LACDB Peptide chain release factor 1 OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC BAA-365) GN=prfA PE=3 SV=1 43 107 6.0E-13
sp|Q03QX7|RF1_LACBA Peptide chain release factor 1 OS=Lactobacillus brevis (strain ATCC 367 / JCM 1170) GN=prfA PE=3 SV=1 9 112 2.0E-12
sp|A0LVP4|RF2_ACIC1 Peptide chain release factor 2 OS=Acidothermus cellulolyticus (strain ATCC 43068 / 11B) GN=prfB PE=3 SV=1 40 100 2.0E-12
sp|P9WHG3|RF1_MYCTU Peptide chain release factor 1 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=prfA PE=1 SV=1 34 100 2.0E-12
sp|P9WHG2|RF1_MYCTO Peptide chain release factor 1 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=prfA PE=3 SV=1 34 100 2.0E-12
sp|A5U1Z8|RF1_MYCTA Peptide chain release factor 1 OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=prfA PE=3 SV=1 34 100 2.0E-12
sp|C1AMU3|RF1_MYCBT Peptide chain release factor 1 OS=Mycobacterium bovis (strain BCG / Tokyo 172 / ATCC 35737 / TMC 1019) GN=prfA PE=3 SV=1 34 100 2.0E-12
sp|A1KI87|RF1_MYCBP Peptide chain release factor 1 OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=prfA PE=3 SV=1 34 100 2.0E-12
sp|P66017|RF1_MYCBO Peptide chain release factor 1 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=prfA PE=3 SV=1 34 100 2.0E-12
sp|A0JYC5|RF2_ARTS2 Peptide chain release factor 2 OS=Arthrobacter sp. (strain FB24) GN=prfB PE=3 SV=1 40 123 2.0E-12
sp|Q38WJ4|RF1_LACSS Peptide chain release factor 1 OS=Lactobacillus sakei subsp. sakei (strain 23K) GN=prfA PE=3 SV=1 50 115 3.0E-12
sp|P45833|RF1_MYCLE Peptide chain release factor 1 OS=Mycobacterium leprae (strain TN) GN=prfA PE=3 SV=2 34 100 3.0E-12
sp|B8ZR31|RF1_MYCLB Peptide chain release factor 1 OS=Mycobacterium leprae (strain Br4923) GN=prfA PE=3 SV=1 34 100 3.0E-12
sp|Q042K5|RF1_LACGA Peptide chain release factor 1 OS=Lactobacillus gasseri (strain ATCC 33323 / DSM 20243 / JCM 1131 / NCIMB 11718 / AM63) GN=prfA PE=3 SV=1 50 107 4.0E-12
sp|Q1B542|RF1_MYCSS Peptide chain release factor 1 OS=Mycobacterium sp. (strain MCS) GN=prfA PE=3 SV=1 34 107 4.0E-12
sp|A1UJZ5|RF1_MYCSK Peptide chain release factor 1 OS=Mycobacterium sp. (strain KMS) GN=prfA PE=3 SV=1 34 107 4.0E-12
sp|A3Q3C2|RF1_MYCSJ Peptide chain release factor 1 OS=Mycobacterium sp. (strain JLS) GN=prfA PE=3 SV=1 34 107 4.0E-12
sp|Q74K25|RF1_LACJO Peptide chain release factor 1 OS=Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533) GN=prfA PE=3 SV=1 50 107 4.0E-12
sp|A9WPT6|RF2_RENSM Peptide chain release factor 2 OS=Renibacterium salmoninarum (strain ATCC 33209 / DSM 20767 / JCM 11484 / NBRC 15589 / NCIMB 2235) GN=prfB PE=3 SV=1 40 123 4.0E-12
sp|Q1WUD6|RF1_LACS1 Peptide chain release factor 1 OS=Lactobacillus salivarius (strain UCC118) GN=prfA PE=3 SV=1 9 111 5.0E-12
sp|A6SUF6|RF1_JANMA Peptide chain release factor 1 OS=Janthinobacterium sp. (strain Marseille) GN=prfA PE=3 SV=1 50 112 5.0E-12
sp|Q5FKZ0|RF1_LACAC Peptide chain release factor 1 OS=Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM) GN=prfA PE=3 SV=1 50 107 5.0E-12
sp|Q88UT2|RF1_LACPL Peptide chain release factor 1 OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=prfA PE=3 SV=1 43 131 5.0E-12
sp|A8YUJ1|RF1_LACH4 Peptide chain release factor 1 OS=Lactobacillus helveticus (strain DPC 4571) GN=prfA PE=3 SV=1 50 107 6.0E-12
sp|A0QCW7|RF1_MYCA1 Peptide chain release factor 1 OS=Mycobacterium avium (strain 104) GN=prfA PE=3 SV=1 32 100 6.0E-12
sp|Q73X48|RF1_MYCPA Peptide chain release factor 1 OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=prfA PE=3 SV=1 34 112 6.0E-12
sp|A0RQM7|RF2_CAMFF Peptide chain release factor 2 OS=Campylobacter fetus subsp. fetus (strain 82-40) GN=prfB PE=3 SV=1 32 113 6.0E-12
sp|B2GAT1|RF1_LACF3 Peptide chain release factor 1 OS=Lactobacillus fermentum (strain NBRC 3956 / LMG 18251) GN=prfA PE=3 SV=1 50 108 7.0E-12
sp|B2G676|RF1_LACRJ Peptide chain release factor 1 OS=Lactobacillus reuteri (strain JCM 1112) GN=prfA PE=3 SV=1 50 112 8.0E-12
sp|Q5P7G7|RF1_AROAE Peptide chain release factor 1 OS=Aromatoleum aromaticum (strain EbN1) GN=prfA PE=3 SV=1 49 112 8.0E-12
sp|A0PUL1|RF1_MYCUA Peptide chain release factor 1 OS=Mycobacterium ulcerans (strain Agy99) GN=prfA PE=3 SV=1 32 100 8.0E-12
sp|A0QU58|RF2_MYCS2 Peptide chain release factor 2 OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=prfB PE=1 SV=1 40 100 9.0E-12
sp|Q8FQ31|RF1_COREF Peptide chain release factor 1 OS=Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395) GN=prfA PE=3 SV=1 32 100 9.0E-12
sp|Q5YR52|RF2_NOCFA Peptide chain release factor 2 OS=Nocardia farcinica (strain IFM 10152) GN=prfB PE=3 SV=1 40 100 9.0E-12
sp|A8M3R1|RF2_SALAI Peptide chain release factor 2 OS=Salinispora arenicola (strain CNS-205) GN=prfB PE=3 SV=1 40 100 1.0E-11
sp|A4T8L3|RF1_MYCGI Peptide chain release factor 1 OS=Mycobacterium gilvum (strain PYR-GCK) GN=prfA PE=3 SV=1 32 100 1.0E-11
sp|A4X3K6|RF2_SALTO Peptide chain release factor 2 OS=Salinispora tropica (strain ATCC BAA-916 / DSM 44818 / CNB-440) GN=prfB PE=3 SV=1 40 100 1.0E-11
sp|Q6NIM2|RF2_CORDI Peptide chain release factor 2 OS=Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis) GN=prfB PE=3 SV=1 40 100 1.0E-11
sp|Q748B1|RF1_GEOSL Peptide chain release factor 1 OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=prfA PE=3 SV=1 50 109 1.0E-11
sp|A8ZTL8|RF1_DESOH Peptide chain release factor 1 OS=Desulfococcus oleovorans (strain DSM 6200 / Hxd3) GN=prfA PE=3 SV=1 42 112 1.0E-11
sp|B2HQL3|RF1_MYCMM Peptide chain release factor 1 OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=prfA PE=3 SV=1 34 100 1.0E-11
sp|A1TD66|RF1_MYCVP Peptide chain release factor 1 OS=Mycobacterium vanbaalenii (strain DSM 7251 / PYR-1) GN=prfA PE=3 SV=1 34 107 1.0E-11
sp|Q1LIF3|RF1_CUPMC Peptide chain release factor 1 OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=prfA PE=3 SV=2 31 103 2.0E-11
sp|Q5Z0Z2|RF1_NOCFA Peptide chain release factor 1 OS=Nocardia farcinica (strain IFM 10152) GN=prfA PE=3 SV=1 32 99 2.0E-11
sp|C3PES4|RF2_CORA7 Peptide chain release factor 2 OS=Corynebacterium aurimucosum (strain ATCC 700975 / DSM 44827 / CN-1) GN=prfB PE=3 SV=1 40 100 2.0E-11
sp|B1MEU8|RF2_MYCA9 Peptide chain release factor 2 OS=Mycobacterium abscessus (strain ATCC 19977 / DSM 44196 / CIP 104536 / JCM 13569 / NCTC 13031 / TMC 1543) GN=prfB PE=3 SV=1 40 100 2.0E-11
sp|B0SXB7|RF2_CAUSK Peptide chain release factor 2 OS=Caulobacter sp. (strain K31) GN=prfB PE=3 SV=1 42 100 2.0E-11
sp|Q9PMK5|RF2_CAMJE Peptide chain release factor 2 OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=prfB PE=3 SV=1 48 116 2.0E-11
sp|Q5HSX6|RF2_CAMJR Peptide chain release factor 2 OS=Campylobacter jejuni (strain RM1221) GN=prfB PE=3 SV=1 48 116 2.0E-11
sp|A3PWV0|RF2_MYCSJ Peptide chain release factor 2 OS=Mycobacterium sp. (strain JLS) GN=prfB PE=3 SV=1 40 100 2.0E-11
sp|A1W163|RF2_CAMJJ Peptide chain release factor 2 OS=Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176) GN=prfB PE=3 SV=1 48 116 2.0E-11
sp|Q82D82|RF2_STRAW Peptide chain release factor 2 OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=prfB PE=3 SV=1 41 102 2.0E-11
sp|Q53915|RF2_STRCO Peptide chain release factor 2 OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=prfB PE=3 SV=2 41 100 2.0E-11
sp|Q5HB80|RF1_EHRRW Peptide chain release factor 1 OS=Ehrlichia ruminantium (strain Welgevonden) GN=prfA PE=3 SV=1 50 133 2.0E-11
sp|Q5FGZ2|RF1_EHRRG Peptide chain release factor 1 OS=Ehrlichia ruminantium (strain Gardel) GN=prfA PE=3 SV=1 50 133 2.0E-11
sp|Q1BBL5|RF2_MYCSS Peptide chain release factor 2 OS=Mycobacterium sp. (strain MCS) GN=prfB PE=3 SV=1 40 100 2.0E-11
sp|A1UDD2|RF2_MYCSK Peptide chain release factor 2 OS=Mycobacterium sp. (strain KMS) GN=prfB PE=3 SV=1 40 100 2.0E-11
sp|A1SHH9|RF1_NOCSJ Peptide chain release factor 1 OS=Nocardioides sp. (strain BAA-499 / JS614) GN=prfA PE=3 SV=1 41 133 3.0E-11
sp|B3R722|RF1_CUPTR Peptide chain release factor 1 OS=Cupriavidus taiwanensis (strain R1 / LMG 19424) GN=prfA PE=3 SV=1 31 112 3.0E-11
sp|Q9A752|RF2_CAUCR Peptide chain release factor 2 OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=prfB PE=3 SV=1 42 100 3.0E-11
sp|B8GWM3|RF2_CAUCN Peptide chain release factor 2 OS=Caulobacter crescentus (strain NA1000 / CB15N) GN=prfB PE=3 SV=1 42 100 3.0E-11
sp|Q46WS9|RF1_CUPPJ Peptide chain release factor 1 OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=prfA PE=3 SV=1 42 112 3.0E-11
sp|A4TDE5|RF2_MYCGI Peptide chain release factor 2 OS=Mycobacterium gilvum (strain PYR-GCK) GN=prfB PE=3 SV=1 40 100 3.0E-11
sp|A6WEK6|RF2_KINRD Peptide chain release factor 2 OS=Kineococcus radiotolerans (strain ATCC BAA-149 / DSM 14245 / SRS30216) GN=prfB PE=3 SV=1 40 100 3.0E-11
sp|A8FNC2|RF2_CAMJ8 Peptide chain release factor 2 OS=Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828) GN=prfB PE=3 SV=1 48 116 3.0E-11
sp|A6W1C2|RF1_MARMS Peptide chain release factor 1 OS=Marinomonas sp. (strain MWYL1) GN=prfA PE=3 SV=1 49 100 3.0E-11
sp|C0QTI3|RF1_PERMH Peptide chain release factor 1 OS=Persephonella marina (strain DSM 14350 / EX-H1) GN=prfA PE=3 SV=1 39 102 3.0E-11
sp|Q2Y5P3|RF1_NITMU Peptide chain release factor 1 OS=Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849) GN=prfA PE=3 SV=1 49 112 3.0E-11
sp|Q39YQ1|RF1_GEOMG Peptide chain release factor 1 OS=Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210) GN=prfA PE=3 SV=1 50 133 3.0E-11
sp|A1T6D1|RF2_MYCVP Peptide chain release factor 2 OS=Mycobacterium vanbaalenii (strain DSM 7251 / PYR-1) GN=prfB PE=3 SV=1 40 100 3.0E-11
sp|Q8XVD0|RF1_RALSO Peptide chain release factor 1 OS=Ralstonia solanacearum (strain GMI1000) GN=prfA PE=3 SV=1 49 102 4.0E-11
sp|A4F8R2|RF2_SACEN Peptide chain release factor 2 OS=Saccharopolyspora erythraea (strain ATCC 11635 / DSM 40517 / JCM 4748 / NBRC 13426 / NCIMB 8594 / NRRL 2338) GN=prfB PE=3 SV=1 40 100 4.0E-11
sp|B3WDK7|RF1_LACCB Peptide chain release factor 1 OS=Lactobacillus casei (strain BL23) GN=prfA PE=3 SV=1 9 115 4.0E-11
sp|Q03A29|RF1_LACC3 Peptide chain release factor 1 OS=Lactobacillus casei (strain ATCC 334) GN=prfA PE=3 SV=1 9 115 4.0E-11
sp|Q3SG10|RF1_THIDA Peptide chain release factor 1 OS=Thiobacillus denitrificans (strain ATCC 25259) GN=prfA PE=3 SV=1 49 102 4.0E-11
sp|B9L0E3|RF2_THERP Peptide chain release factor 2 OS=Thermomicrobium roseum (strain ATCC 27502 / DSM 5159 / P-2) GN=prfB PE=3 SV=1 41 103 4.0E-11
sp|A0QJS1|RF2_MYCA1 Peptide chain release factor 2 OS=Mycobacterium avium (strain 104) GN=prfB PE=3 SV=1 40 100 4.0E-11
sp|B1VV08|RF2_STRGG Peptide chain release factor 2 OS=Streptomyces griseus subsp. griseus (strain JCM 4626 / NBRC 13350) GN=prfB PE=3 SV=1 41 100 5.0E-11
sp|Q8NR57|RF1_CORGL Peptide chain release factor 1 OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=prfA PE=3 SV=1 32 100 5.0E-11
sp|A4QDG1|RF1_CORGB Peptide chain release factor 1 OS=Corynebacterium glutamicum (strain R) GN=prfA PE=3 SV=1 32 100 5.0E-11
sp|A0PQZ6|RF2_MYCUA Peptide chain release factor 2 OS=Mycobacterium ulcerans (strain Agy99) GN=prfB PE=3 SV=1 40 100 5.0E-11
sp|B2HGJ2|RF2_MYCMM Peptide chain release factor 2 OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=prfB PE=3 SV=1 40 100 5.0E-11
sp|Q6NHU0|RF1_CORDI Peptide chain release factor 1 OS=Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis) GN=prfA PE=3 SV=1 34 100 5.0E-11
sp|Q2SUG2|RF1_BURTA Peptide chain release factor 1 OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=prfA PE=3 SV=1 49 115 5.0E-11
sp|Q63QF0|RF1_BURPS Peptide chain release factor 1 OS=Burkholderia pseudomallei (strain K96243) GN=prfA PE=3 SV=1 49 115 6.0E-11
sp|A3NE24|RF1_BURP6 Peptide chain release factor 1 OS=Burkholderia pseudomallei (strain 668) GN=prfA PE=3 SV=1 49 115 6.0E-11
sp|Q3JN85|RF1_BURP1 Peptide chain release factor 1 OS=Burkholderia pseudomallei (strain 1710b) GN=prfA PE=3 SV=1 49 115 6.0E-11
sp|A3NZS4|RF1_BURP0 Peptide chain release factor 1 OS=Burkholderia pseudomallei (strain 1106a) GN=prfA PE=3 SV=1 49 115 6.0E-11
sp|A1UWC9|RF1_BURMS Peptide chain release factor 1 OS=Burkholderia mallei (strain SAVP1) GN=prfA PE=3 SV=1 49 115 6.0E-11
sp|Q62DF3|RF1_BURMA Peptide chain release factor 1 OS=Burkholderia mallei (strain ATCC 23344) GN=prfA PE=3 SV=1 49 115 6.0E-11
sp|A2RYL2|RF1_BURM9 Peptide chain release factor 1 OS=Burkholderia mallei (strain NCTC 10229) GN=prfA PE=3 SV=1 49 115 6.0E-11
sp|A3MFT4|RF1_BURM7 Peptide chain release factor 1 OS=Burkholderia mallei (strain NCTC 10247) GN=prfA PE=3 SV=1 49 115 6.0E-11
sp|Q0BIQ0|RF1_BURCM Peptide chain release factor 1 OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=prfA PE=3 SV=1 49 115 6.0E-11
sp|B1YSD5|RF1_BURA4 Peptide chain release factor 1 OS=Burkholderia ambifaria (strain MC40-6) GN=prfA PE=3 SV=1 49 115 6.0E-11
sp|A4JB50|RF1_BURVG Peptide chain release factor 1 OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) GN=prfA PE=3 SV=1 49 115 6.0E-11
sp|B4E6U6|RF1_BURCJ Peptide chain release factor 1 OS=Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610) GN=prfA PE=3 SV=1 49 115 6.0E-11
sp|Q2W3F8|RF2_MAGSA Peptide chain release factor 2 OS=Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) GN=prfB PE=3 SV=1 41 100 6.0E-11
sp|A0K437|RF1_BURCH Peptide chain release factor 1 OS=Burkholderia cenocepacia (strain HI2424) GN=prfA PE=3 SV=1 49 115 6.0E-11
sp|B1JUS4|RF1_BURCC Peptide chain release factor 1 OS=Burkholderia cenocepacia (strain MC0-3) GN=prfA PE=3 SV=1 49 115 6.0E-11
sp|Q1BSB1|RF1_BURCA Peptide chain release factor 1 OS=Burkholderia cenocepacia (strain AU 1054) GN=prfA PE=3 SV=1 49 115 6.0E-11
sp|Q88YL5|RF2_LACPL Peptide chain release factor 2 OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=prfB PE=3 SV=2 50 100 6.0E-11
sp|Q21FM3|RF1_SACD2 Peptide chain release factor 1 OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=prfA PE=3 SV=1 49 100 7.0E-11
sp|Q7W023|RF1_BORPE Peptide chain release factor 1 OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=prfA PE=3 SV=1 42 102 7.0E-11
sp|Q7WQE9|RF1_BORBR Peptide chain release factor 1 OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=prfA PE=3 SV=1 42 102 7.0E-11
sp|A1K443|RF1_AZOSB Peptide chain release factor 1 OS=Azoarcus sp. (strain BH72) GN=prfA PE=3 SV=1 49 102 7.0E-11
sp|Q7WCE3|RF1_BORPA Peptide chain release factor 1 OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=prfA PE=3 SV=1 42 102 7.0E-11
sp|Q9ZMR1|RF2_HELPJ Peptide chain release factor 2 OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=prfB PE=3 SV=1 48 109 7.0E-11
sp|Q39K18|RF1_BURL3 Peptide chain release factor 1 OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=prfA PE=3 SV=1 49 115 7.0E-11
sp|B1MLV1|RF1_MYCA9 Peptide chain release factor 1 OS=Mycobacterium abscessus (strain ATCC 19977 / DSM 44196 / CIP 104536 / JCM 13569 / NCTC 13031 / TMC 1543) GN=prfA PE=3 SV=1 9 121 7.0E-11
sp|Q13TU2|RF1_BURXL Peptide chain release factor 1 OS=Burkholderia xenovorans (strain LB400) GN=prfA PE=3 SV=1 31 112 7.0E-11
sp|P55999|RF2_HELPY Peptide chain release factor 2 OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=prfB PE=3 SV=1 48 109 8.0E-11
sp|B2US00|RF2_HELPS Peptide chain release factor 2 OS=Helicobacter pylori (strain Shi470) GN=prfB PE=3 SV=1 48 109 8.0E-11
sp|B2UDM7|RF1_RALPJ Peptide chain release factor 1 OS=Ralstonia pickettii (strain 12J) GN=prfA PE=3 SV=1 49 102 8.0E-11
sp|Q1CUY8|RF2_HELPH Peptide chain release factor 2 OS=Helicobacter pylori (strain HPAG1) GN=prfB PE=3 SV=1 48 109 8.0E-11
sp|Q17YT5|RF2_HELAH Peptide chain release factor 2 OS=Helicobacter acinonychis (strain Sheeba) GN=prfB PE=3 SV=1 48 109 8.0E-11
sp|B2SZ27|RF1_BURPP Peptide chain release factor 1 OS=Burkholderia phytofirmans (strain DSM 17436 / PsJN) GN=prfA PE=3 SV=1 31 112 8.0E-11
sp|B5Z9U4|RF2_HELPG Peptide chain release factor 2 OS=Helicobacter pylori (strain G27) GN=prfB PE=3 SV=1 48 109 8.0E-11
sp|A6WSF0|RF1_SHEB8 Peptide chain release factor 1 OS=Shewanella baltica (strain OS185) GN=prfA PE=3 SV=1 49 100 8.0E-11
sp|B2GLX4|RF1_KOCRD Peptide chain release factor 1 OS=Kocuria rhizophila (strain ATCC 9341 / DSM 348 / NBRC 103217 / DC2201) GN=prfA PE=3 SV=1 34 142 8.0E-11
sp|C0ZXD0|RF2_RHOE4 Peptide chain release factor 2 OS=Rhodococcus erythropolis (strain PR4 / NBRC 100887) GN=prfB PE=3 SV=1 41 100 8.0E-11
sp|A9L2D4|RF1_SHEB9 Peptide chain release factor 1 OS=Shewanella baltica (strain OS195) GN=prfA PE=3 SV=1 49 100 8.0E-11
sp|A7ZE19|RF2_CAMC1 Peptide chain release factor 2 OS=Campylobacter concisus (strain 13826) GN=prfB PE=3 SV=1 50 114 8.0E-11
sp|A3D0G1|RF1_SHEB5 Peptide chain release factor 1 OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=prfA PE=3 SV=1 49 100 9.0E-11
sp|B8E815|RF1_SHEB2 Peptide chain release factor 1 OS=Shewanella baltica (strain OS223) GN=prfA PE=3 SV=1 49 100 9.0E-11
sp|A6Q582|RF2_NITSB Peptide chain release factor 2 OS=Nitratiruptor sp. (strain SB155-2) GN=prfB PE=3 SV=1 50 125 9.0E-11
sp|A1RNE1|RF1_SHESW Peptide chain release factor 1 OS=Shewanella sp. (strain W3-18-1) GN=prfA PE=3 SV=1 49 100 9.0E-11
sp|A4Y3J8|RF1_SHEPC Peptide chain release factor 1 OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=prfA PE=3 SV=1 49 100 9.0E-11
sp|A9G9L1|RF1_SORC5 Peptide chain release factor 1 OS=Sorangium cellulosum (strain So ce56) GN=prfA PE=3 SV=1 41 103 9.0E-11
sp|B0KNE4|RF1_PSEPG Peptide chain release factor 1 OS=Pseudomonas putida (strain GB-1) GN=prfA PE=3 SV=1 36 103 9.0E-11
sp|B0TR27|RF1_SHEHH Peptide chain release factor 1 OS=Shewanella halifaxensis (strain HAW-EB4) GN=prfA PE=3 SV=1 49 100 9.0E-11
sp|B4SHV0|RF2_STRM5 Peptide chain release factor 2 OS=Stenotrophomonas maltophilia (strain R551-3) GN=prfB PE=3 SV=1 50 133 9.0E-11
sp|A1U367|RF1_MARHV Peptide chain release factor 1 OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=prfA PE=3 SV=1 49 115 9.0E-11
sp|A7H5G4|RF2_CAMJD Peptide chain release factor 2 OS=Campylobacter jejuni subsp. doylei (strain ATCC BAA-1458 / RM4099 / 269.97) GN=prfB PE=3 SV=1 48 112 9.0E-11
sp|A9IER8|RF1_BORPD Peptide chain release factor 1 OS=Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448) GN=prfA PE=3 SV=1 49 102 9.0E-11
sp|A8H7A5|RF1_SHEPA Peptide chain release factor 1 OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=prfA PE=3 SV=1 49 100 9.0E-11
sp|Q2GGM5|RF1_EHRCR Peptide chain release factor 1 OS=Ehrlichia chaffeensis (strain ATCC CRL-10679 / Arkansas) GN=prfA PE=3 SV=1 50 133 9.0E-11
sp|Q88PW5|RF1_PSEPK Peptide chain release factor 1 OS=Pseudomonas putida (strain KT2440) GN=prfA PE=3 SV=1 36 103 1.0E-10
sp|A9M1Q8|RF1_NEIM0 Peptide chain release factor 1 OS=Neisseria meningitidis serogroup C (strain 053442) GN=prfA PE=3 SV=1 49 102 1.0E-10
sp|A5VYG5|RF1_PSEP1 Peptide chain release factor 1 OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=prfA PE=3 SV=1 36 103 1.0E-10
sp|A1KV95|RF1_NEIMF Peptide chain release factor 1 OS=Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18) GN=prfA PE=3 SV=1 49 102 1.0E-10
sp|Q5F750|RF1_NEIG1 Peptide chain release factor 1 OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=prfA PE=3 SV=1 49 102 1.0E-10
sp|B4RN52|RF1_NEIG2 Peptide chain release factor 1 OS=Neisseria gonorrhoeae (strain NCCP11945) GN=prfA PE=3 SV=1 49 102 1.0E-10
sp|Q8NS78|RF2_CORGL Peptide chain release factor 2 OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=prfB PE=3 SV=1 40 100 1.0E-10
sp|A4QCD3|RF2_CORGB Peptide chain release factor 2 OS=Corynebacterium glutamicum (strain R) GN=prfB PE=3 SV=1 40 100 1.0E-10
sp|Q9JT75|RF1_NEIMA Peptide chain release factor 1 OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=prfA PE=3 SV=1 49 102 1.0E-10
sp|Q8EAR3|RF1_SHEON Peptide chain release factor 1 OS=Shewanella oneidensis (strain MR-1) GN=prfA PE=3 SV=1 49 100 1.0E-10
sp|Q0HYK8|RF1_SHESR Peptide chain release factor 1 OS=Shewanella sp. (strain MR-7) GN=prfA PE=3 SV=1 49 100 1.0E-10
sp|Q0HFC8|RF1_SHESM Peptide chain release factor 1 OS=Shewanella sp. (strain MR-4) GN=prfA PE=3 SV=1 49 100 1.0E-10
sp|C5BSZ6|RF1_TERTT Peptide chain release factor 1 OS=Teredinibacter turnerae (strain ATCC 39867 / T7901) GN=prfA PE=3 SV=1 31 101 1.0E-10
sp|Q2KZZ3|RF1_BORA1 Peptide chain release factor 1 OS=Bordetella avium (strain 197N) GN=prfA PE=3 SV=2 49 102 1.0E-10
sp|A0KT88|RF1_SHESA Peptide chain release factor 1 OS=Shewanella sp. (strain ANA-3) GN=prfA PE=3 SV=1 49 100 1.0E-10
sp|Q9JY93|RF1_NEIMB Peptide chain release factor 1 OS=Neisseria meningitidis serogroup B (strain MC58) GN=prfA PE=3 SV=1 49 102 1.0E-10
sp|B9L5Y7|RF2_NAUPA Peptide chain release factor 2 OS=Nautilia profundicola (strain ATCC BAA-1463 / DSM 18972 / AmH) GN=prfB PE=3 SV=1 49 125 1.0E-10
sp|A9AJ68|RF1_BURM1 Peptide chain release factor 1 OS=Burkholderia multivorans (strain ATCC 17616 / 249) GN=prfA PE=3 SV=1 31 115 1.0E-10
sp|B4RCR3|RF2_PHEZH Peptide chain release factor 2 OS=Phenylobacterium zucineum (strain HLK1) GN=prfB PE=3 SV=1 50 103 1.0E-10
sp|Q3IK95|RF1_PSEHT Peptide chain release factor 1 OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=prfA PE=3 SV=1 49 100 1.0E-10
sp|Q6A808|RF2_PROAC Peptide chain release factor 2 OS=Propionibacterium acnes (strain KPA171202 / DSM 16379) GN=prfB PE=3 SV=1 40 100 1.0E-10
sp|B2JHK8|RF1_BURP8 Peptide chain release factor 1 OS=Burkholderia phymatum (strain DSM 17167 / STM815) GN=prfA PE=3 SV=1 49 115 1.0E-10
sp|Q02G09|RF1_PSEAB Peptide chain release factor 1 OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=prfA PE=3 SV=1 36 102 1.0E-10
sp|B7V0L1|RF1_PSEA8 Peptide chain release factor 1 OS=Pseudomonas aeruginosa (strain LESB58) GN=prfA PE=3 SV=1 36 102 1.0E-10
sp|P42806|RF1_PSEAE Peptide chain release factor 1 OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=prfA PE=3 SV=2 36 102 1.0E-10
sp|Q98RA5|RF1_MYCPU Peptide chain release factor 1 OS=Mycoplasma pulmonis (strain UAB CTIP) GN=prfA PE=3 SV=1 49 133 1.0E-10
sp|O67032|RF1_AQUAE Peptide chain release factor 1 OS=Aquifex aeolicus (strain VF5) GN=prfA PE=3 SV=1 39 102 2.0E-10
sp|Q1IEX1|RF1_PSEE4 Peptide chain release factor 1 OS=Pseudomonas entomophila (strain L48) GN=prfA PE=3 SV=1 36 103 2.0E-10
sp|Q31IN8|RF1_THICR Peptide chain release factor 1 OS=Thiomicrospira crunogena (strain XCL-2) GN=prfA PE=3 SV=1 49 115 2.0E-10
sp|B1JEP6|RF1_PSEPW Peptide chain release factor 1 OS=Pseudomonas putida (strain W619) GN=prfA PE=3 SV=1 36 103 2.0E-10
sp|Q0ARZ8|RF1_MARMM Peptide chain release factor 1 OS=Maricaulis maris (strain MCS10) GN=prfA PE=3 SV=1 49 103 2.0E-10
sp|O32885|RF2_MYCLE Peptide chain release factor 2 OS=Mycobacterium leprae (strain TN) GN=prfB PE=3 SV=1 40 100 2.0E-10
sp|B8ZUV0|RF2_MYCLB Peptide chain release factor 2 OS=Mycobacterium leprae (strain Br4923) GN=prfB PE=3 SV=1 40 100 2.0E-10
sp|B2U8V1|RF2_RALPJ Peptide chain release factor 2 OS=Ralstonia pickettii (strain 12J) GN=prfB PE=3 SV=1 50 100 2.0E-10
sp|Q7P1Y2|RF1_CHRVO Peptide chain release factor 1 OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=prfA PE=3 SV=1 49 103 2.0E-10
sp|P9WHG1|RF2_MYCTU Peptide chain release factor 2 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=prfB PE=1 SV=1 40 100 2.0E-10
sp|P9WHG0|RF2_MYCTO Peptide chain release factor 2 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=prfB PE=3 SV=1 40 100 2.0E-10
sp|P66027|RF2_MYCBO Peptide chain release factor 2 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=prfB PE=3 SV=1 40 100 2.0E-10
sp|B6JPR7|RF2_HELP2 Peptide chain release factor 2 OS=Helicobacter pylori (strain P12) GN=prfB PE=3 SV=1 48 111 2.0E-10
sp|Q6KIA0|RF1_MYCMO Peptide chain release factor 1 OS=Mycoplasma mobile (strain ATCC 43663 / 163K / NCTC 11711) GN=prfA PE=3 SV=1 49 136 2.0E-10
sp|Q47Y94|RF1_COLP3 Peptide chain release factor 1 OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=prfA PE=3 SV=1 49 100 2.0E-10
sp|B8HB03|RF1_ARTCA Peptide chain release factor 1 OS=Arthrobacter chlorophenolicus (strain ATCC 700700 / DSM 12829 / JCM 12360 / NCIMB 13794 / A6) GN=prfA PE=3 SV=1 34 142 2.0E-10
sp|C4LJM5|RF1_CORK4 Peptide chain release factor 1 OS=Corynebacterium kroppenstedtii (strain DSM 44385 / CCUG 35717) GN=prfA PE=3 SV=1 32 100 2.0E-10
sp|B8DTL4|RF1_BIFA0 Peptide chain release factor 1 OS=Bifidobacterium animalis subsp. lactis (strain AD011) GN=prfA PE=3 SV=1 49 112 2.0E-10
sp|A4SV43|RF1_POLSQ Peptide chain release factor 1 OS=Polynucleobacter necessarius subsp. asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1) GN=prfA PE=3 SV=1 42 102 2.0E-10
sp|Q1MSG7|RF1_LAWIP Peptide chain release factor 1 OS=Lawsonia intracellularis (strain PHE/MN1-00) GN=prfA PE=3 SV=1 40 115 2.0E-10
sp|C1B1L3|RF2_RHOOB Peptide chain release factor 2 OS=Rhodococcus opacus (strain B4) GN=prfB PE=3 SV=1 41 100 2.0E-10
sp|Q0S2Q6|RF2_RHOJR Peptide chain release factor 2 OS=Rhodococcus jostii (strain RHA1) GN=prfB PE=3 SV=1 41 100 2.0E-10
sp|Q1GPK3|RF1_SPHAL Peptide chain release factor 1 OS=Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256) GN=prfA PE=3 SV=1 41 115 2.0E-10
sp|Q2GKS8|RF1_ANAPZ Peptide chain release factor 1 OS=Anaplasma phagocytophilum (strain HZ) GN=prfA PE=3 SV=1 50 136 2.0E-10
sp|Q7U3W6|RF2_SYNPX Peptide chain release factor 2 OS=Synechococcus sp. (strain WH8102) GN=prfB PE=3 SV=1 40 133 2.0E-10
sp|B8CQV2|RF1_SHEPW Peptide chain release factor 1 OS=Shewanella piezotolerans (strain WP3 / JCM 13877) GN=prfA PE=3 SV=1 49 100 3.0E-10
sp|A0JY78|RF1_ARTS2 Peptide chain release factor 1 OS=Arthrobacter sp. (strain FB24) GN=prfA PE=3 SV=1 34 112 3.0E-10
sp|A6LN93|RF2_THEM4 Peptide chain release factor 2 OS=Thermosipho melanesiensis (strain DSM 12029 / CIP 104789 / BI429) GN=prfB PE=3 SV=1 50 100 3.0E-10
sp|Q3YS23|RF1_EHRCJ Peptide chain release factor 1 OS=Ehrlichia canis (strain Jake) GN=prfA PE=3 SV=1 50 133 3.0E-10
sp|Q1D2Q9|RF1_MYXXD Peptide chain release factor 1 OS=Myxococcus xanthus (strain DK 1622) GN=prfA PE=3 SV=1 42 103 3.0E-10
sp|Q93NC7|RF1_MYXXA Peptide chain release factor 1 OS=Myxococcus xanthus GN=prfA PE=3 SV=1 42 103 3.0E-10
sp|B0SQV0|RF1_LEPBP Peptide chain release factor 1 OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / ATCC 23582 / Paris) GN=prfA PE=3 SV=1 41 102 3.0E-10
sp|B0SH84|RF1_LEPBA Peptide chain release factor 1 OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / Ames) GN=prfA PE=3 SV=1 41 102 3.0E-10
sp|B1KDU3|RF1_SHEWM Peptide chain release factor 1 OS=Shewanella woodyi (strain ATCC 51908 / MS32) GN=prfA PE=3 SV=1 49 100 3.0E-10
sp|A0KMZ8|RF1_AERHH Peptide chain release factor 1 OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=prfA PE=3 SV=1 42 100 3.0E-10
sp|B3PJP4|RF1_CELJU Peptide chain release factor 1 OS=Cellvibrio japonicus (strain Ueda107) GN=prfA PE=3 SV=1 50 100 3.0E-10
sp|C1DEV0|RF1_AZOVD Peptide chain release factor 1 OS=Azotobacter vinelandii (strain DJ / ATCC BAA-1303) GN=prfA PE=3 SV=1 36 102 3.0E-10
sp|A4VPB9|RF1_PSEU5 Peptide chain release factor 1 OS=Pseudomonas stutzeri (strain A1501) GN=prfA PE=3 SV=1 31 136 3.0E-10
sp|A3QH30|RF1_SHELP Peptide chain release factor 1 OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=prfA PE=3 SV=1 49 100 3.0E-10
sp|B7IE81|RF2_THEAB Peptide chain release factor 2 OS=Thermosipho africanus (strain TCF52B) GN=prfB PE=3 SV=1 50 103 3.0E-10
sp|A6VC61|RF1_PSEA7 Peptide chain release factor 1 OS=Pseudomonas aeruginosa (strain PA7) GN=prfA PE=3 SV=1 36 102 3.0E-10
sp|Q4K695|RF1_PSEF5 Peptide chain release factor 1 OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=prfA PE=3 SV=1 36 102 4.0E-10
sp|B4EDB1|RF2_BURCJ Peptide chain release factor 2 OS=Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610) GN=prfB PE=3 SV=1 32 130 4.0E-10
sp|B9L5Z9|RF1_NAUPA Peptide chain release factor 1 OS=Nautilia profundicola (strain ATCC BAA-1463 / DSM 18972 / AmH) GN=prfA PE=3 SV=1 39 133 4.0E-10
sp|Q3SVP7|RF1_NITWN Peptide chain release factor 1 OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=prfA PE=3 SV=1 39 102 4.0E-10
sp|A7I0P7|RF2_CAMHC Peptide chain release factor 2 OS=Campylobacter hominis (strain ATCC BAA-381 / LMG 19568 / NCTC 13146 / CH001A) GN=prfB PE=3 SV=1 41 103 4.0E-10
sp|Q087I4|RF1_SHEFN Peptide chain release factor 1 OS=Shewanella frigidimarina (strain NCIMB 400) GN=prfA PE=3 SV=1 49 100 4.0E-10
sp|A1W9H4|RF2_ACISJ Peptide chain release factor 2 OS=Acidovorax sp. (strain JS42) GN=prfB PE=3 SV=1 42 103 4.0E-10
sp|B9MBK7|RF2_ACIET Peptide chain release factor 2 OS=Acidovorax ebreus (strain TPSY) GN=prfB PE=3 SV=1 42 103 4.0E-10
sp|Q12QR8|RF1_SHEDO Peptide chain release factor 1 OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=prfA PE=3 SV=1 49 100 4.0E-10
sp|Q9X183|RF1_THEMA Peptide chain release factor 1 OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=prfA PE=1 SV=1 49 111 4.0E-10
sp|B9KEY7|RF2_CAMLR Peptide chain release factor 2 OS=Campylobacter lari (strain RM2100 / D67 / ATCC BAA-1060) GN=prfB PE=3 SV=1 48 108 5.0E-10
sp|Q63SP0|RF2_BURPS Peptide chain release factor 2 OS=Burkholderia pseudomallei (strain K96243) GN=prfB PE=3 SV=1 32 100 5.0E-10
sp|A3NX26|RF2_BURP0 Peptide chain release factor 2 OS=Burkholderia pseudomallei (strain 1106a) GN=prfB PE=3 SV=3 32 100 5.0E-10
sp|Q62J00|RF2_BURMA Peptide chain release factor 2 OS=Burkholderia mallei (strain ATCC 23344) GN=prfB PE=3 SV=1 32 100 5.0E-10
sp|Q8RD98|RF1_CALS4 Peptide chain release factor 1 OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=prfA PE=3 SV=1 42 110 5.0E-10
sp|Q1QQY7|RF1_NITHX Peptide chain release factor 1 OS=Nitrobacter hamburgensis (strain X14 / DSM 10229) GN=prfA PE=3 SV=1 49 102 5.0E-10
sp|Q65TB1|RF1_MANSM Peptide chain release factor 1 OS=Mannheimia succiniciproducens (strain MBEL55E) GN=prfA PE=3 SV=1 40 100 5.0E-10
sp|Q15SQ9|RF1_PSEA6 Peptide chain release factor 1 OS=Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) GN=prfA PE=3 SV=1 49 103 5.0E-10
sp|Q1GYE8|RF1_METFK Peptide chain release factor 1 OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) GN=prfA PE=3 SV=1 49 100 5.0E-10
sp|Q89XT9|RF1_BRADU Peptide chain release factor 1 OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=prfA PE=3 SV=1 49 102 6.0E-10
sp|B6JA06|RF1_OLICO Peptide chain release factor 1 OS=Oligotropha carboxidovorans (strain ATCC 49405 / DSM 1227 / OM5) GN=prfA PE=3 SV=1 49 102 6.0E-10
sp|A1A0I9|RF1_BIFAA Peptide chain release factor 1 OS=Bifidobacterium adolescentis (strain ATCC 15703 / DSM 20083 / NCTC 11814 / E194a) GN=prfA PE=3 SV=1 49 112 6.0E-10
sp|B0S2B6|RF1_FINM2 Peptide chain release factor 1 OS=Finegoldia magna (strain ATCC 29328) GN=prfA PE=3 SV=1 49 111 6.0E-10
sp|A8FYZ0|RF1_SHESH Peptide chain release factor 1 OS=Shewanella sediminis (strain HAW-EB3) GN=prfA PE=3 SV=1 49 100 6.0E-10
sp|C4LBL5|RF1_TOLAT Peptide chain release factor 1 OS=Tolumonas auensis (strain DSM 9187 / TA4) GN=prfA PE=3 SV=1 31 100 6.0E-10
sp|Q0C0Y0|RF2_HYPNA Peptide chain release factor 2 OS=Hyphomonas neptunium (strain ATCC 15444) GN=prfB PE=3 SV=1 42 103 6.0E-10
sp|A5FX99|RF1_ACICJ Peptide chain release factor 1 OS=Acidiphilium cryptum (strain JF-5) GN=prfA PE=3 SV=1 41 100 6.0E-10
sp|P96077|RF1_THET8 Peptide chain release factor 1 OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=prfA PE=1 SV=1 43 103 6.0E-10
sp|Q72HB8|RF1_THET2 Peptide chain release factor 1 OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=prfA PE=1 SV=1 43 103 6.0E-10
sp|Q5WUB1|RF1_LEGPL Peptide chain release factor 1 OS=Legionella pneumophila (strain Lens) GN=prfA PE=3 SV=1 50 102 6.0E-10
sp|Q5ZT29|RF1_LEGPH Peptide chain release factor 1 OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=prfA PE=3 SV=1 50 102 6.0E-10
sp|Q5X2V3|RF1_LEGPA Peptide chain release factor 1 OS=Legionella pneumophila (strain Paris) GN=prfA PE=3 SV=1 50 102 6.0E-10
sp|Q2N5U6|RF1_ERYLH Peptide chain release factor 1 OS=Erythrobacter litoralis (strain HTCC2594) GN=prfA PE=3 SV=1 50 115 7.0E-10
sp|B8GLA1|RF1_THISH Peptide chain release factor 1 OS=Thioalkalivibrio sulfidiphilus (strain HL-EbGR7) GN=prfA PE=3 SV=1 50 100 7.0E-10
sp|A5IED7|RF1_LEGPC Peptide chain release factor 1 OS=Legionella pneumophila (strain Corby) GN=prfA PE=3 SV=1 50 102 7.0E-10
sp|Q7MAP4|RF2_WOLSU Peptide chain release factor 2 OS=Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / LMG 7466 / NCTC 11488 / FDC 602W) GN=prfB PE=3 SV=1 50 103 7.0E-10
sp|B2V5M0|RF2_SULSY Peptide chain release factor 2 OS=Sulfurihydrogenibium sp. (strain YO3AOP1) GN=prfB PE=3 SV=1 7 100 7.0E-10
sp|Q2L224|RF2_BORA1 Peptide chain release factor 2 OS=Bordetella avium (strain 197N) GN=prfB PE=3 SV=1 50 103 7.0E-10
sp|Q6F9S2|RF1_ACIAD Peptide chain release factor 1 OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=prfA PE=3 SV=2 50 102 7.0E-10
sp|C3KDC6|RF1_PSEFS Peptide chain release factor 1 OS=Pseudomonas fluorescens (strain SBW25) GN=prfA PE=3 SV=1 36 102 8.0E-10
sp|B8JAU2|RF1_ANAD2 Peptide chain release factor 1 OS=Anaeromyxobacter dehalogenans (strain 2CP-1 / ATCC BAA-258) GN=prfA PE=3 SV=1 42 112 8.0E-10
sp|B1XSY0|RF1_POLNS Peptide chain release factor 1 OS=Polynucleobacter necessarius subsp. necessarius (strain STIR1) GN=prfA PE=3 SV=1 42 102 8.0E-10
sp|Q2IMW2|RF1_ANADE Peptide chain release factor 1 OS=Anaeromyxobacter dehalogenans (strain 2CP-C) GN=prfA PE=3 SV=1 42 112 8.0E-10
sp|B4UAY8|RF1_ANASK Peptide chain release factor 1 OS=Anaeromyxobacter sp. (strain K) GN=prfA PE=3 SV=1 42 112 8.0E-10
sp|Q82TH4|RF1_NITEU Peptide chain release factor 1 OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=prfA PE=3 SV=1 49 115 8.0E-10
sp|B4U955|RF1_HYDS0 Peptide chain release factor 1 OS=Hydrogenobaculum sp. (strain Y04AAS1) GN=prfA PE=3 SV=1 49 108 9.0E-10
sp|C5CUX0|RF2_VARPS Peptide chain release factor 2 OS=Variovorax paradoxus (strain S110) GN=prfB PE=3 SV=1 49 133 9.0E-10
sp|Q4ZXW7|RF1_PSEU2 Peptide chain release factor 1 OS=Pseudomonas syringae pv. syringae (strain B728a) GN=prfA PE=3 SV=1 36 102 9.0E-10
sp|A1SV89|RF1_PSYIN Peptide chain release factor 1 OS=Psychromonas ingrahamii (strain 37) GN=prfA PE=3 SV=1 49 100 9.0E-10
sp|Q2J6M0|RF1_FRASC Peptide chain release factor 1 OS=Frankia sp. (strain CcI3) GN=prfA PE=3 SV=1 49 100 1.0E-09
sp|Q3A129|RF1_PELCD Peptide chain release factor 1 OS=Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1) GN=prfA PE=3 SV=1 50 112 1.0E-09
sp|Q13F02|RF1_RHOPS Peptide chain release factor 1 OS=Rhodopseudomonas palustris (strain BisB5) GN=prfA PE=3 SV=1 49 102 1.0E-09
sp|Q48MV4|RF1_PSE14 Peptide chain release factor 1 OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=prfA PE=3 SV=1 36 102 1.0E-09
sp|A6WXQ3|RF1_OCHA4 Peptide chain release factor 1 OS=Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / NCTC 12168) GN=prfA PE=3 SV=1 49 131 1.0E-09
sp|O51101|RF2_BORBU Peptide chain release factor 2 OS=Borrelia burgdorferi (strain ATCC 35210 / B31 / CIP 102532 / DSM 4680) GN=prfB PE=3 SV=3 50 100 1.0E-09
sp|B1LB88|RF2_THESQ Peptide chain release factor 2 OS=Thermotoga sp. (strain RQ2) GN=prfB PE=3 SV=1 49 103 1.0E-09
sp|B8I562|RF1_CLOCE Peptide chain release factor 1 OS=Clostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10) GN=prfA PE=3 SV=1 50 108 1.0E-09
sp|Q9X1R5|RF2_THEMA Peptide chain release factor 2 OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=prfB PE=3 SV=1 49 103 1.0E-09
sp|Q47M70|RF1_THEFY Peptide chain release factor 1 OS=Thermobifida fusca (strain YX) GN=prfA PE=3 SV=1 30 96 1.0E-09
sp|Q888C1|RF1_PSESM Peptide chain release factor 1 OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=prfA PE=3 SV=1 36 102 1.0E-09
sp|Q07VB3|RF1_RHOP5 Peptide chain release factor 1 OS=Rhodopseudomonas palustris (strain BisA53) GN=prfA PE=3 SV=1 49 102 1.0E-09
sp|B3QCF6|RF1_RHOPT Peptide chain release factor 1 OS=Rhodopseudomonas palustris (strain TIE-1) GN=prfA PE=3 SV=1 49 102 1.0E-09
sp|Q6NC66|RF1_RHOPA Peptide chain release factor 1 OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=prfA PE=3 SV=1 49 102 1.0E-09
sp|A5IM04|RF2_THEP1 Peptide chain release factor 2 OS=Thermotoga petrophila (strain RKU-1 / ATCC BAA-488 / DSM 13995) GN=prfB PE=3 SV=1 49 103 1.0E-09
sp|A9BHH8|RF2_PETMO Peptide chain release factor 2 OS=Petrotoga mobilis (strain DSM 10674 / SJ95) GN=prfB PE=3 SV=1 50 105 1.0E-09
sp|O67695|RF2_AQUAE Peptide chain release factor 2 OS=Aquifex aeolicus (strain VF5) GN=prfB PE=3 SV=1 49 100 1.0E-09
sp|A4SK64|RF1_AERS4 Peptide chain release factor 1 OS=Aeromonas salmonicida (strain A449) GN=prfA PE=3 SV=1 49 100 1.0E-09
sp|Q2J423|RF1_RHOP2 Peptide chain release factor 1 OS=Rhodopseudomonas palustris (strain HaA2) GN=prfA PE=3 SV=2 49 102 1.0E-09
sp|A8MJX9|RF1_ALKOO Peptide chain release factor 1 OS=Alkaliphilus oremlandii (strain OhILAs) GN=prfA PE=3 SV=1 42 112 1.0E-09
sp|C3PFQ4|RF1_CORA7 Peptide chain release factor 1 OS=Corynebacterium aurimucosum (strain ATCC 700975 / DSM 44827 / CN-1) GN=prfA PE=3 SV=1 50 103 1.0E-09
sp|B4RSV6|RF1_ALTMD Peptide chain release factor 1 OS=Alteromonas macleodii (strain DSM 17117 / Deep ecotype) GN=prfA1 PE=3 SV=1 49 103 1.0E-09
sp|O83090|RF1_TREPA Peptide chain release factor 1 OS=Treponema pallidum (strain Nichols) GN=prfA PE=3 SV=1 49 103 1.0E-09
sp|B2S1Z9|RF1_TREPS Peptide chain release factor 1 OS=Treponema pallidum subsp. pallidum (strain SS14) GN=prfA PE=3 SV=1 49 103 1.0E-09
sp|Q4JUI9|RF1_CORJK Peptide chain release factor 1 OS=Corynebacterium jeikeium (strain K411) GN=prfA PE=3 SV=1 41 103 1.0E-09
sp|Q4QKS1|RF1_HAEI8 Peptide chain release factor 1 OS=Haemophilus influenzae (strain 86-028NP) GN=prfA PE=3 SV=2 50 112 1.0E-09
sp|Q98G93|RF1_RHILO Peptide chain release factor 1 OS=Rhizobium loti (strain MAFF303099) GN=prfA PE=3 SV=1 49 103 1.0E-09
sp|A8EWG5|RF2_ARCB4 Peptide chain release factor 2 OS=Arcobacter butzleri (strain RM4018) GN=prfB PE=3 SV=1 50 100 1.0E-09
sp|Q0AC04|RF1_ALKEH Peptide chain release factor 1 OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=prfA PE=3 SV=1 42 100 1.0E-09
sp|B8DLL6|RF1_DESVM Peptide chain release factor 1 OS=Desulfovibrio vulgaris (strain Miyazaki F / DSM 19637) GN=prfA PE=3 SV=1 49 110 1.0E-09
sp|B3DR51|RF1_BIFLD Peptide chain release factor 1 OS=Bifidobacterium longum (strain DJO10A) GN=prfA PE=3 SV=1 49 112 1.0E-09
sp|P43917|RF1_HAEIN Peptide chain release factor 1 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=prfA PE=3 SV=2 50 112 1.0E-09
sp|A1AX02|RF1_RUTMC Peptide chain release factor 1 OS=Ruthia magnifica subsp. Calyptogena magnifica GN=prfA PE=3 SV=1 31 110 1.0E-09
sp|Q479R5|RF1_DECAR Peptide chain release factor 1 OS=Dechloromonas aromatica (strain RCB) GN=prfA PE=3 SV=1 49 115 1.0E-09
sp|A3M6N7|RF1_ACIBT Peptide chain release factor 1 OS=Acinetobacter baumannii (strain ATCC 17978 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377) GN=prfA PE=3 SV=2 50 102 1.0E-09
sp|B0VM26|RF1_ACIBS Peptide chain release factor 1 OS=Acinetobacter baumannii (strain SDF) GN=prfA PE=3 SV=1 50 102 1.0E-09
sp|B2HU82|RF1_ACIBC Peptide chain release factor 1 OS=Acinetobacter baumannii (strain ACICU) GN=prfA PE=3 SV=1 50 102 1.0E-09
sp|Q8G3P5|RF1_BIFLO Peptide chain release factor 1 OS=Bifidobacterium longum (strain NCC 2705) GN=prfA PE=3 SV=1 49 112 1.0E-09
sp|A8AY61|RF2_STRGC Peptide chain release factor 2 OS=Streptococcus gordonii (strain Challis / ATCC 35105 / CH1 / DL1 / V288) GN=prfB PE=3 SV=1 41 133 1.0E-09
sp|Q8KG45|RF1_CHLTE Peptide chain release factor 1 OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=prfA PE=3 SV=1 49 111 2.0E-09
sp|B7GP74|RF1_BIFLS Peptide chain release factor 1 OS=Bifidobacterium longum subsp. infantis (strain ATCC 15697 / DSM 20088 / JCM 1222 / NCTC 11817 / S12) GN=prfA PE=3 SV=1 49 112 2.0E-09
sp|Q6AJM5|RF1_DESPS Peptide chain release factor 1 OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) GN=prfA PE=3 SV=1 42 109 2.0E-09
sp|B0V7E0|RF1_ACIBY Peptide chain release factor 1 OS=Acinetobacter baumannii (strain AYE) GN=prfA PE=3 SV=1 50 102 2.0E-09
sp|B7IBA1|RF1_ACIB5 Peptide chain release factor 1 OS=Acinetobacter baumannii (strain AB0057) GN=prfA PE=3 SV=1 50 102 2.0E-09
sp|B7H0L9|RF1_ACIB3 Peptide chain release factor 1 OS=Acinetobacter baumannii (strain AB307-0294) GN=prfA PE=3 SV=1 50 102 2.0E-09
sp|Q7N586|RF1_PHOLL Peptide chain release factor 1 OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=prfA PE=3 SV=1 36 100 2.0E-09
sp|Q3BUB7|RF2_XANC5 Peptide chain release factor 2 OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=prfB PE=3 SV=1 50 103 2.0E-09
sp|Q8FYK3|RF1_BRUSU Peptide chain release factor 1 OS=Brucella suis biovar 1 (strain 1330) GN=prfA PE=3 SV=1 49 103 2.0E-09
sp|A9M8K5|RF1_BRUC2 Peptide chain release factor 1 OS=Brucella canis (strain ATCC 23365 / NCTC 10854) GN=prfA PE=3 SV=1 49 103 2.0E-09
sp|B0CIC3|RF1_BRUSI Peptide chain release factor 1 OS=Brucella suis (strain ATCC 23445 / NCTC 10510) GN=prfA PE=3 SV=1 49 103 2.0E-09
sp|Q57B22|RF1_BRUAB Peptide chain release factor 1 OS=Brucella abortus biovar 1 (strain 9-941) GN=prfA PE=3 SV=1 49 103 2.0E-09
sp|Q2YLN8|RF1_BRUA2 Peptide chain release factor 1 OS=Brucella abortus (strain 2308) GN=prfA PE=3 SV=1 49 103 2.0E-09
sp|B2S825|RF1_BRUA1 Peptide chain release factor 1 OS=Brucella abortus (strain S19) GN=prfA PE=3 SV=1 49 103 2.0E-09
sp|Q8YJ95|RF1_BRUME Peptide chain release factor 1 OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=prfA PE=3 SV=2 49 103 2.0E-09
sp|C0RFB5|RF1_BRUMB Peptide chain release factor 1 OS=Brucella melitensis biotype 2 (strain ATCC 23457) GN=prfA PE=3 SV=1 49 103 2.0E-09
sp|Q2GE03|RF1_NEOSM Peptide chain release factor 1 OS=Neorickettsia sennetsu (strain Miyayama) GN=prfA PE=3 SV=1 50 103 2.0E-09
sp|Q5KUH3|RF1_GEOKA Peptide chain release factor 1 OS=Geobacillus kaustophilus (strain HTA426) GN=prfA PE=3 SV=1 41 120 2.0E-09
sp|Q92MK5|RF1_RHIME Peptide chain release factor 1 OS=Rhizobium meliloti (strain 1021) GN=prfA PE=3 SV=1 49 131 2.0E-09
sp|Q5PAH2|RF1_ANAMM Peptide chain release factor 1 OS=Anaplasma marginale (strain St. Maries) GN=prfA PE=3 SV=1 50 103 2.0E-09
sp|B9KIV2|RF1_ANAMF Peptide chain release factor 1 OS=Anaplasma marginale (strain Florida) GN=prfA PE=3 SV=1 50 103 2.0E-09
sp|Q30NW2|RF1_SULDN Peptide chain release factor 1 OS=Sulfurimonas denitrificans (strain ATCC 33889 / DSM 1251) GN=prfA PE=3 SV=1 41 103 2.0E-09
sp|B8FEA2|RF1_DESAA Peptide chain release factor 1 OS=Desulfatibacillum alkenivorans (strain AK-01) GN=prfA PE=3 SV=1 42 133 2.0E-09
sp|P57852|RF1_PASMU Peptide chain release factor 1 OS=Pasteurella multocida (strain Pm70) GN=prfA PE=3 SV=1 40 100 2.0E-09
sp|A1URS5|RF1_BARBK Peptide chain release factor 1 OS=Bartonella bacilliformis (strain ATCC 35685 / KC583) GN=prfA PE=3 SV=1 49 103 2.0E-09
sp|A4ITK8|RF1_GEOTN Peptide chain release factor 1 OS=Geobacillus thermodenitrificans (strain NG80-2) GN=prfA PE=3 SV=1 41 102 2.0E-09
sp|B3CQD1|RF1_ORITI Peptide chain release factor 1 OS=Orientia tsutsugamushi (strain Ikeda) GN=prfA PE=3 SV=1 50 103 2.0E-09
sp|Q09691|RF1M_SCHPO Putative peptide chain release factor 1, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC2F7.17 PE=3 SV=1 42 100 2.0E-09
sp|A5CCS8|RF1_ORITB Peptide chain release factor 1 OS=Orientia tsutsugamushi (strain Boryong) GN=prfA PE=3 SV=1 50 103 2.0E-09
sp|Q4A6L9|RF1_MYCS5 Peptide chain release factor 1 OS=Mycoplasma synoviae (strain 53) GN=prfA PE=3 SV=1 49 112 2.0E-09
sp|Q927Y4|RF2_LISIN Peptide chain release factor 2 OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=prfB PE=3 SV=2 31 100 2.0E-09
sp|A1B0G1|RF1_PARDP Peptide chain release factor 1 OS=Paracoccus denitrificans (strain Pd 1222) GN=prfA PE=3 SV=1 40 103 2.0E-09
sp|B3E628|RF1_GEOLS Peptide chain release factor 1 OS=Geobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ) GN=prfA PE=3 SV=1 50 133 2.0E-09
sp|C4Z1S4|RF1_EUBE2 Peptide chain release factor 1 OS=Eubacterium eligens (strain ATCC 27750 / VPI C15-48) GN=prfA PE=3 SV=1 41 103 2.0E-09
sp|A8LLU7|RF1_DINSH Peptide chain release factor 1 OS=Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12) GN=prfA PE=3 SV=1 40 103 2.0E-09
sp|A9W1A4|RF1_METEP Peptide chain release factor 1 OS=Methylobacterium extorquens (strain PA1) GN=prfA PE=3 SV=1 41 102 2.0E-09
sp|B7L246|RF1_METC4 Peptide chain release factor 1 OS=Methylobacterium extorquens (strain CM4 / NCIMB 13688) GN=prfA PE=3 SV=1 41 102 2.0E-09
sp|C5CGS4|RF2_KOSOT Peptide chain release factor 2 OS=Kosmotoga olearia (strain TBF 19.5.1) GN=prfB PE=3 SV=1 50 103 2.0E-09
sp|B0K1F7|RF1_THEPX Peptide chain release factor 1 OS=Thermoanaerobacter sp. (strain X514) GN=prfA PE=3 SV=1 31 133 2.0E-09
sp|B2RZQ6|RF1_BORHD Peptide chain release factor 1 OS=Borrelia hermsii (strain HS1 / DAH) GN=prfA PE=3 SV=1 50 111 2.0E-09
sp|C3LPI4|RF1_VIBCM Peptide chain release factor 1 OS=Vibrio cholerae serotype O1 (strain M66-2) GN=prfA PE=3 SV=1 31 100 3.0E-09
sp|Q9KQ25|RF1_VIBCH Peptide chain release factor 1 OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=prfA PE=3 SV=1 31 100 3.0E-09
sp|A5F696|RF1_VIBC3 Peptide chain release factor 1 OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=prfA PE=3 SV=1 31 100 3.0E-09
sp|B0K7G6|RF1_THEP3 Peptide chain release factor 1 OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) GN=prfA PE=3 SV=1 31 133 3.0E-09
sp|B0UUE6|RF1_HISS2 Peptide chain release factor 1 OS=Histophilus somni (strain 2336) GN=prfA PE=3 SV=1 32 100 3.0E-09
sp|A4XJN1|RF1_CALS8 Peptide chain release factor 1 OS=Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331) GN=prfA PE=3 SV=1 41 111 3.0E-09
sp|C5D9N4|RF1_GEOSW Peptide chain release factor 1 OS=Geobacillus sp. (strain WCH70) GN=prfA PE=3 SV=1 41 102 3.0E-09
sp|Q5QUZ8|RF1_IDILO Peptide chain release factor 1 OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=prfA PE=3 SV=1 49 100 3.0E-09
sp|Q0I3B5|RF1_HAES1 Peptide chain release factor 1 OS=Haemophilus somnus (strain 129Pt) GN=prfA PE=3 SV=1 32 100 3.0E-09
sp|C4Z911|RF1_EUBR3 Peptide chain release factor 1 OS=Eubacterium rectale (strain ATCC 33656 / VPI 0990) GN=prfA PE=3 SV=1 49 103 3.0E-09
sp|A9NEP7|RF1_ACHLI Peptide chain release factor 1 OS=Acholeplasma laidlawii (strain PG-8A) GN=prfA PE=3 SV=1 52 115 3.0E-09
sp|Q5NIA8|RF1_FRATT Peptide chain release factor 1 OS=Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4) GN=prfA PE=3 SV=1 49 100 3.0E-09
sp|Q14JR1|RF1_FRAT1 Peptide chain release factor 1 OS=Francisella tularensis subsp. tularensis (strain FSC 198) GN=prfA PE=3 SV=1 49 100 3.0E-09
sp|Q7VZ35|RF2_BORPE Peptide chain release factor 2 OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=prfB PE=3 SV=1 50 103 3.0E-09
sp|Q7WK44|RF2_BORBR Peptide chain release factor 2 OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=prfB PE=3 SV=1 50 103 3.0E-09
sp|A4IWC1|RF1_FRATW Peptide chain release factor 1 OS=Francisella tularensis subsp. tularensis (strain WY96-3418) GN=prfA PE=3 SV=1 49 100 3.0E-09
sp|Q0BKE8|RF1_FRATO Peptide chain release factor 1 OS=Francisella tularensis subsp. holarctica (strain OSU18) GN=prfA PE=3 SV=1 49 100 3.0E-09
sp|Q2A1Q0|RF1_FRATH Peptide chain release factor 1 OS=Francisella tularensis subsp. holarctica (strain LVS) GN=prfA PE=3 SV=1 49 100 3.0E-09
sp|A7NE96|RF1_FRATF Peptide chain release factor 1 OS=Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA) GN=prfA PE=3 SV=1 49 100 3.0E-09
sp|Q9K4E4|RF1_STRCO Peptide chain release factor 1 OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=prfA PE=3 SV=1 50 100 3.0E-09
sp|B2SFF6|RF1_FRATM Peptide chain release factor 1 OS=Francisella tularensis subsp. mediasiatica (strain FSC147) GN=prfA PE=3 SV=1 49 100 3.0E-09
sp|B0TX37|RF1_FRAP2 Peptide chain release factor 1 OS=Francisella philomiragia subsp. philomiragia (strain ATCC 25017) GN=prfA PE=3 SV=1 49 100 3.0E-09
sp|Q8K9X0|RF1_BUCAP Peptide chain release factor 1 OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=prfA PE=3 SV=1 32 113 3.0E-09
sp|A6W7F6|RF1_KINRD Peptide chain release factor 1 OS=Kineococcus radiotolerans (strain ATCC BAA-149 / DSM 14245 / SRS30216) GN=prfA PE=3 SV=1 42 100 3.0E-09
sp|Q2JEW7|RF2_FRASC Peptide chain release factor 2 OS=Frankia sp. (strain CcI3) GN=prfB PE=3 SV=1 49 100 3.0E-09
sp|C5CXW3|RF1_VARPS Peptide chain release factor 1 OS=Variovorax paradoxus (strain S110) GN=prfA PE=3 SV=1 50 100 3.0E-09
sp|Q7W8T4|RF2_BORPA Peptide chain release factor 2 OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=prfB PE=3 SV=1 50 103 3.0E-09
sp|Q8D2K9|RF1_WIGBR Peptide chain release factor 1 OS=Wigglesworthia glossinidia brevipalpis GN=prfA PE=3 SV=1 49 114 3.0E-09
sp|A5IZH6|RF1_MYCAP Peptide chain release factor 1 OS=Mycoplasma agalactiae (strain PG2) GN=prfA PE=3 SV=1 42 103 3.0E-09
sp|A4XR61|RF1_PSEMY Peptide chain release factor 1 OS=Pseudomonas mendocina (strain ymp) GN=prfA PE=3 SV=1 36 102 3.0E-09
sp|Q30TP0|RF2_SULDN Peptide chain release factor 2 OS=Sulfurimonas denitrificans (strain ATCC 33889 / DSM 1251) GN=prfB PE=3 SV=1 50 112 3.0E-09
sp|Q73JU6|RF1_TREDE Peptide chain release factor 1 OS=Treponema denticola (strain ATCC 35405 / CIP 103919 / DSM 14222) GN=prfA PE=3 SV=1 49 103 4.0E-09
sp|A8F531|RF2_PSELT Peptide chain release factor 2 OS=Pseudothermotoga lettingae (strain ATCC BAA-301 / DSM 14385 / NBRC 107922 / TMO) GN=prfB PE=3 SV=1 49 100 4.0E-09
sp|Q6G5T7|RF1_BARHE Peptide chain release factor 1 OS=Bartonella henselae (strain ATCC 49882 / DSM 28221 / Houston 1) GN=prfA PE=3 SV=1 49 103 4.0E-09
sp|A0LIZ8|RF1_SYNFM Peptide chain release factor 1 OS=Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB) GN=prfA PE=3 SV=1 49 112 4.0E-09
sp|A5G8T7|RF1_GEOUR Peptide chain release factor 1 OS=Geobacter uraniireducens (strain Rf4) GN=prfA PE=3 SV=1 50 109 4.0E-09
sp|A9HJ50|RF1_GLUDA Peptide chain release factor 1 OS=Gluconacetobacter diazotrophicus (strain ATCC 49037 / DSM 5601 / PAl5) GN=prfA PE=3 SV=1 50 100 4.0E-09
sp|Q4FSV3|RF1_PSYA2 Peptide chain release factor 1 OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=prfA PE=3 SV=1 40 100 4.0E-09
sp|P28369|RFH_ECOLI Putative peptide chain release factor homolog OS=Escherichia coli (strain K12) GN=prfH PE=5 SV=2 49 132 4.0E-09
sp|Q1QAW3|RF1_PSYCK Peptide chain release factor 1 OS=Psychrobacter cryohalolentis (strain K5) GN=prfA PE=3 SV=1 40 100 4.0E-09
sp|Q0AHU1|RF1_NITEC Peptide chain release factor 1 OS=Nitrosomonas eutropha (strain C91) GN=prfA PE=3 SV=1 49 102 4.0E-09
sp|A1S8R2|RF1_SHEAM Peptide chain release factor 1 OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=prfA PE=3 SV=1 42 100 4.0E-09
sp|A9IMM3|RF1_BART1 Peptide chain release factor 1 OS=Bartonella tribocorum (strain CIP 105476 / IBS 506) GN=prfA PE=3 SV=1 49 103 4.0E-09
sp|A5WFG1|RF1_PSYWF Peptide chain release factor 1 OS=Psychrobacter sp. (strain PRwf-1) GN=prfA PE=3 SV=1 40 100 4.0E-09
sp|Q12F86|RF1_POLSJ Peptide chain release factor 1 OS=Polaromonas sp. (strain JS666 / ATCC BAA-500) GN=prfA PE=3 SV=1 50 100 4.0E-09
sp|B8E003|RF1_DICTD Peptide chain release factor 1 OS=Dictyoglomus turgidum (strain Z-1310 / DSM 6724) GN=prfA PE=3 SV=1 49 100 4.0E-09
sp|Q01RX8|RF1_SOLUE Peptide chain release factor 1 OS=Solibacter usitatus (strain Ellin6076) GN=prfA PE=3 SV=1 52 109 4.0E-09
sp|C6BYQ4|RF1_DESAD Peptide chain release factor 1 OS=Desulfovibrio salexigens (strain ATCC 14822 / DSM 2638 / NCIB 8403 / VKM B-1763) GN=prfA PE=3 SV=1 49 100 4.0E-09
sp|Q6G0R0|RF1_BARQU Peptide chain release factor 1 OS=Bartonella quintana (strain Toulouse) GN=prfA PE=3 SV=1 49 103 4.0E-09
sp|B9MR68|RF1_CALBD Peptide chain release factor 1 OS=Caldicellulosiruptor bescii (strain ATCC BAA-1888 / DSM 6725 / Z-1320) GN=prfA PE=3 SV=1 41 111 4.0E-09
sp|B4EVR7|RF1_PROMH Peptide chain release factor 1 OS=Proteus mirabilis (strain HI4320) GN=prfA PE=3 SV=1 31 100 4.0E-09
sp|Q898Y5|RF1_CLOTE Peptide chain release factor 1 OS=Clostridium tetani (strain Massachusetts / E88) GN=prfA PE=3 SV=1 50 133 5.0E-09
sp|Q6LNB4|RF1_PHOPR Peptide chain release factor 1 OS=Photobacterium profundum GN=prfA PE=3 SV=1 40 100 5.0E-09
sp|B8F526|RF1_HAEPS Peptide chain release factor 1 OS=Haemophilus parasuis serovar 5 (strain SH0165) GN=prfA PE=3 SV=1 40 100 5.0E-09
sp|B3GZJ0|RF1_ACTP7 Peptide chain release factor 1 OS=Actinobacillus pleuropneumoniae serotype 7 (strain AP76) GN=prfA PE=3 SV=1 40 100 5.0E-09
sp|A7HTY3|RF1_PARL1 Peptide chain release factor 1 OS=Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966) GN=prfA PE=3 SV=1 43 102 5.0E-09
sp|B5YDB2|RF1_DICT6 Peptide chain release factor 1 OS=Dictyoglomus thermophilum (strain ATCC 35947 / DSM 3960 / H-6-12) GN=prfA PE=3 SV=1 49 100 5.0E-09
sp|Q2MGI2|RF2_STRPN Peptide chain release factor 2 OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=prfB PE=3 SV=1 41 133 5.0E-09
sp|A7HI45|RF1_ANADF Peptide chain release factor 1 OS=Anaeromyxobacter sp. (strain Fw109-5) GN=prfA PE=3 SV=1 42 103 5.0E-09
sp|A0Q844|RF1_FRATN Peptide chain release factor 1 OS=Francisella tularensis subsp. novicida (strain U112) GN=prfA PE=3 SV=1 49 100 5.0E-09
sp|Q11E04|RF1_CHESB Peptide chain release factor 1 OS=Chelativorans sp. (strain BNC1) GN=prfA PE=3 SV=1 49 112 5.0E-09
sp|Q9A9V5|RF1_CAUCR Peptide chain release factor 1 OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=prfA PE=3 SV=2 41 103 5.0E-09
sp|C3PMX2|RF2_RICAE Peptide chain release factor 2 OS=Rickettsia africae (strain ESF-5) GN=prfB PE=3 SV=1 49 133 5.0E-09
sp|Q7VIE6|RF2_HELHP Peptide chain release factor 2 OS=Helicobacter hepaticus (strain ATCC 51449 / 3B1) GN=prfB PE=3 SV=1 50 103 6.0E-09
sp|A0LSK4|RF1_ACIC1 Peptide chain release factor 1 OS=Acidothermus cellulolyticus (strain ATCC 43068 / 11B) GN=prfA PE=3 SV=1 49 99 6.0E-09
sp|Q0SGN8|RF1_RHOJR Peptide chain release factor 1 OS=Rhodococcus jostii (strain RHA1) GN=prfA PE=3 SV=1 41 96 6.0E-09
sp|A1VAK8|RF1_DESVV Peptide chain release factor 1 OS=Desulfovibrio vulgaris subsp. vulgaris (strain DP4) GN=prfA PE=3 SV=1 50 111 6.0E-09
sp|Q727E1|RF1_DESVH Peptide chain release factor 1 OS=Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / NCIMB 8303) GN=prfA PE=3 SV=1 50 111 6.0E-09
sp|A1JRU0|RF1_YERE8 Peptide chain release factor 1 OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=prfA PE=3 SV=1 49 100 6.0E-09
sp|Q0BUJ8|RF1_GRABC Peptide chain release factor 1 OS=Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1) GN=prfA PE=3 SV=1 41 100 6.0E-09
sp|B4RQU4|RF2_NEIG2 Peptide chain release factor 2 OS=Neisseria gonorrhoeae (strain NCCP11945) GN=prfB PE=3 SV=1 50 103 6.0E-09
sp|Q5F5H5|RF2_NEIG1 Peptide chain release factor 2 OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=prfB PE=3 SV=1 50 103 6.0E-09
sp|A9WNB3|RF1_RENSM Peptide chain release factor 1 OS=Renibacterium salmoninarum (strain ATCC 33209 / DSM 20767 / JCM 11484 / NBRC 15589 / NCIMB 2235) GN=prfA PE=3 SV=1 41 142 6.0E-09
sp|Q87A17|RF1_XYLFT Peptide chain release factor 1 OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=prfA PE=3 SV=1 49 131 6.0E-09
sp|B2IA85|RF1_XYLF2 Peptide chain release factor 1 OS=Xylella fastidiosa (strain M23) GN=prfA PE=3 SV=1 49 131 6.0E-09
sp|Q4L4H9|RF2_STAHJ Peptide chain release factor 2 OS=Staphylococcus haemolyticus (strain JCSC1435) GN=prfB PE=3 SV=2 49 112 6.0E-09
sp|Q5NZU2|RF2_AROAE Peptide chain release factor 2 OS=Aromatoleum aromaticum (strain EbN1) GN=prfB PE=3 SV=1 50 103 6.0E-09
sp|Q9K6F4|RF1_BACHD Peptide chain release factor 1 OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=prfA PE=3 SV=1 52 115 6.0E-09
sp|A5CW65|RF1_VESOH Peptide chain release factor 1 OS=Vesicomyosocius okutanii subsp. Calyptogena okutanii (strain HA) GN=prfA PE=3 SV=1 49 102 6.0E-09
sp|A1KWK6|RF2_NEIMF Peptide chain release factor 2 OS=Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18) GN=prfB PE=3 SV=1 50 103 6.0E-09
sp|Q1AVG5|RF1_RUBXD Peptide chain release factor 1 OS=Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129) GN=prfA PE=3 SV=1 42 100 6.0E-09
sp|Q7VMV9|RF1_HAEDU Peptide chain release factor 1 OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=prfA PE=3 SV=1 40 113 7.0E-09
sp|P30775|RF1M_YEAST Peptide chain release factor 1, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MRF1 PE=1 SV=1 43 100 7.0E-09
sp|Q9JXB3|RF2_NEIMB Peptide chain release factor 2 OS=Neisseria meningitidis serogroup B (strain MC58) GN=prfB PE=3 SV=1 50 103 7.0E-09
sp|Q9JWV4|RF2_NEIMA Peptide chain release factor 2 OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=prfB PE=3 SV=1 50 103 7.0E-09
sp|Q66AX5|RF1_YERPS Peptide chain release factor 1 OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=prfA PE=3 SV=1 49 100 7.0E-09
sp|A4WRK0|RF1_RHOS5 Peptide chain release factor 1 OS=Rhodobacter sphaeroides (strain ATCC 17025 / ATH 2.4.3) GN=prfA PE=3 SV=1 40 103 7.0E-09
sp|B1JM85|RF1_YERPY Peptide chain release factor 1 OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=prfA PE=3 SV=1 49 100 7.0E-09
sp|A4TJN7|RF1_YERPP Peptide chain release factor 1 OS=Yersinia pestis (strain Pestoides F) GN=prfA PE=3 SV=1 49 100 7.0E-09
sp|Q1CJK1|RF1_YERPN Peptide chain release factor 1 OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=prfA PE=3 SV=1 49 100 7.0E-09
sp|A9QZ08|RF1_YERPG Peptide chain release factor 1 OS=Yersinia pestis bv. Antiqua (strain Angola) GN=prfA PE=3 SV=1 49 100 7.0E-09
sp|Q8ZEX8|RF1_YERPE Peptide chain release factor 1 OS=Yersinia pestis GN=prfA PE=3 SV=1 49 100 7.0E-09
sp|B2K2Z0|RF1_YERPB Peptide chain release factor 1 OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=prfA PE=3 SV=1 49 100 7.0E-09
sp|Q1C854|RF1_YERPA Peptide chain release factor 1 OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=prfA PE=3 SV=1 49 100 7.0E-09
sp|A7FIG1|RF1_YERP3 Peptide chain release factor 1 OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=prfA PE=3 SV=1 49 100 7.0E-09
sp|Q30X18|RF1_DESAG Peptide chain release factor 1 OS=Desulfovibrio alaskensis (strain G20) GN=prfA PE=3 SV=1 50 100 7.0E-09
sp|Q71WR9|RF2_LISMF Peptide chain release factor 2 OS=Listeria monocytogenes serotype 4b (strain F2365) GN=prfB PE=3 SV=1 31 100 7.0E-09
sp|Q6AG71|RF1_LEIXX Peptide chain release factor 1 OS=Leifsonia xyli subsp. xyli (strain CTCB07) GN=prfA PE=3 SV=1 49 100 7.0E-09
sp|A7I3Q0|RF1_CAMHC Peptide chain release factor 1 OS=Campylobacter hominis (strain ATCC BAA-381 / LMG 19568 / NCTC 13146 / CH001A) GN=prfA PE=3 SV=1 41 103 7.0E-09
sp|Q82J70|RF1_STRAW Peptide chain release factor 1 OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=prfA PE=3 SV=1 50 100 7.0E-09
sp|B0UAV4|RF1_METS4 Peptide chain release factor 1 OS=Methylobacterium sp. (strain 4-46) GN=prfA PE=3 SV=1 41 100 7.0E-09
sp|Q831F6|RF1_ENTFA Peptide chain release factor 1 OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=prfA PE=3 SV=1 52 102 7.0E-09
sp|Q1RIY5|RF2_RICBR Peptide chain release factor 2 OS=Rickettsia bellii (strain RML369-C) GN=prfB PE=3 SV=1 49 133 8.0E-09
sp|B1W0B6|RF1_STRGG Peptide chain release factor 1 OS=Streptomyces griseus subsp. griseus (strain JCM 4626 / NBRC 13350) GN=prfA PE=3 SV=1 50 100 8.0E-09
sp|A2SD46|RF1_METPP Peptide chain release factor 1 OS=Methylibium petroleiphilum (strain PM1) GN=prfA PE=3 SV=1 50 102 8.0E-09
sp|Q92IQ2|RF2_RICCN Peptide chain release factor 2 OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=prfB PE=3 SV=1 49 133 8.0E-09
sp|Q3A928|RF1_CARHZ Peptide chain release factor 1 OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=prfA PE=3 SV=1 52 102 8.0E-09
sp|Q0TNE1|RF2_CLOP1 Peptide chain release factor 2 OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) GN=prfB PE=3 SV=2 50 103 8.0E-09
sp|Q5NMC7|RF1_ZYMMO Peptide chain release factor 1 OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=prfA PE=3 SV=1 49 100 8.0E-09
sp|B1Z914|RF1_METPB Peptide chain release factor 1 OS=Methylobacterium populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001) GN=prfA PE=3 SV=1 41 102 8.0E-09
sp|Q67TD5|RF1_SYMTH Peptide chain release factor 1 OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=prfA PE=3 SV=1 50 111 8.0E-09
sp|A1QYZ0|RF1_BORT9 Peptide chain release factor 1 OS=Borrelia turicatae (strain 91E135) GN=prfA PE=3 SV=1 50 111 8.0E-09
sp|Q1QXC6|RF1_CHRSD Peptide chain release factor 1 OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=prfA PE=3 SV=1 49 100 8.0E-09
sp|A1WI56|RF1_VEREI Peptide chain release factor 1 OS=Verminephrobacter eiseniae (strain EF01-2) GN=prfA PE=3 SV=1 31 102 8.0E-09
sp|A3DIL4|RF1_CLOTH Peptide chain release factor 1 OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) GN=prfA PE=3 SV=1 50 108 8.0E-09
sp|Q0SR12|RF2_CLOPS Peptide chain release factor 2 OS=Clostridium perfringens (strain SM101 / Type A) GN=prfB PE=3 SV=1 50 103 8.0E-09
sp|A6Q6B4|RF1_SULNB Peptide chain release factor 1 OS=Sulfurovum sp. (strain NBC37-1) GN=prfA PE=3 SV=1 42 100 9.0E-09
sp|A0LDT7|RF1_MAGMM Peptide chain release factor 1 OS=Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1) GN=prfA PE=3 SV=1 50 102 9.0E-09
sp|A9NF23|RF2_ACHLI Peptide chain release factor 2 OS=Acholeplasma laidlawii (strain PG-8A) GN=prfB PE=3 SV=1 49 100 9.0E-09
sp|Q8CPZ1|RF2_STAES Peptide chain release factor 2 OS=Staphylococcus epidermidis (strain ATCC 12228) GN=prfB PE=3 SV=2 49 133 9.0E-09
sp|Q5HQX5|RF2_STAEQ Peptide chain release factor 2 OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=prfB PE=3 SV=1 49 133 9.0E-09
sp|Q8Y4D8|RF2_LISMO Peptide chain release factor 2 OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=prfB PE=3 SV=2 50 100 9.0E-09
sp|Q04GC3|RF2_OENOB Peptide chain release factor 2 OS=Oenococcus oeni (strain ATCC BAA-331 / PSU-1) GN=prfB PE=3 SV=1 50 100 9.0E-09
sp|B3CL87|RF1_WOLPP Peptide chain release factor 1 OS=Wolbachia pipientis subsp. Culex pipiens (strain wPip) GN=prfA PE=3 SV=1 43 103 1.0E-08
sp|B1I6L2|RF1_DESAP Peptide chain release factor 1 OS=Desulforudis audaxviator (strain MP104C) GN=prfA PE=3 SV=1 52 112 1.0E-08
sp|A1ASD1|RF1_PELPD Peptide chain release factor 1 OS=Pelobacter propionicus (strain DSM 2379) GN=prfA PE=3 SV=1 50 109 1.0E-08
sp|Q6MRK9|RF1_BDEBA Peptide chain release factor 1 OS=Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIB 9529 / HD100) GN=prfA PE=3 SV=1 40 103 1.0E-08
sp|B7J4M2|RF2_ACIF2 Peptide chain release factor 2 OS=Acidithiobacillus ferrooxidans (strain ATCC 23270 / DSM 14882 / CIP 104768 / NCIMB 8455) GN=prfB PE=3 SV=1 50 120 1.0E-08
sp|Q601F9|RF1_MYCH2 Peptide chain release factor 1 OS=Mycoplasma hyopneumoniae (strain 232) GN=prfA PE=3 SV=1 36 103 1.0E-08
sp|Q4AAJ5|RF1_MYCHJ Peptide chain release factor 1 OS=Mycoplasma hyopneumoniae (strain J / ATCC 25934 / NCTC 10110) GN=prfA PE=3 SV=1 36 103 1.0E-08
sp|A6Q718|RF2_SULNB Peptide chain release factor 2 OS=Sulfurovum sp. (strain NBC37-1) GN=prfB PE=3 SV=1 50 125 1.0E-08
sp|Q4A8M6|RF1_MYCH7 Peptide chain release factor 1 OS=Mycoplasma hyopneumoniae (strain 7448) GN=prfA PE=3 SV=1 36 103 1.0E-08
sp|B7J1C9|RF1_BORBZ Peptide chain release factor 1 OS=Borrelia burgdorferi (strain ZS7) GN=prfA PE=3 SV=1 50 100 1.0E-08
sp|O51214|RF1_BORBU Peptide chain release factor 1 OS=Borrelia burgdorferi (strain ATCC 35210 / B31 / CIP 102532 / DSM 4680) GN=prfA PE=3 SV=1 50 100 1.0E-08
sp|A3PJZ6|RF1_RHOS1 Peptide chain release factor 1 OS=Rhodobacter sphaeroides (strain ATCC 17029 / ATH 2.4.9) GN=prfA PE=3 SV=1 40 103 1.0E-08
sp|Q2K3T1|RF1_RHIEC Peptide chain release factor 1 OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=prfA PE=3 SV=2 49 102 1.0E-08
sp|B3QRH7|RF1_CHLP8 Peptide chain release factor 1 OS=Chlorobaculum parvum (strain NCIB 8327) GN=prfA PE=3 SV=1 49 111 1.0E-08
sp|Q3J2B6|RF1_RHOS4 Peptide chain release factor 1 OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=prfA PE=3 SV=1 40 103 1.0E-08
sp|A8FID1|RF1_BACP2 Peptide chain release factor 1 OS=Bacillus pumilus (strain SAFR-032) GN=prfA PE=3 SV=1 41 115 1.0E-08
sp|Q662G9|RF1_BORBP Peptide chain release factor 1 OS=Borrelia bavariensis (strain ATCC BAA-2496 / DSM 23469 / PBi) GN=prfA PE=3 SV=1 50 100 1.0E-08
sp|B3QYI4|RF1_CHLT3 Peptide chain release factor 1 OS=Chloroherpeton thalassium (strain ATCC 35110 / GB-78) GN=prfA PE=3 SV=1 50 110 1.0E-08
sp|P45872|RF1_BACSU Peptide chain release factor 1 OS=Bacillus subtilis (strain 168) GN=prfA PE=3 SV=1 52 115 1.0E-08
sp|B9KE98|RF1_CAMLR Peptide chain release factor 1 OS=Campylobacter lari (strain RM2100 / D67 / ATCC BAA-1060) GN=prfA PE=3 SV=1 49 133 1.0E-08
sp|Q6GB76|RF2_STAAS Peptide chain release factor 2 OS=Staphylococcus aureus (strain MSSA476) GN=prfB PE=3 SV=1 49 112 1.0E-08
sp|Q7A6R4|RF2_STAAN Peptide chain release factor 2 OS=Staphylococcus aureus (strain N315) GN=prfB PE=1 SV=2 49 112 1.0E-08
sp|Q99VM1|RF2_STAAM Peptide chain release factor 2 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=prfB PE=3 SV=2 49 112 1.0E-08
sp|Q5HHR5|RF2_STAAC Peptide chain release factor 2 OS=Staphylococcus aureus (strain COL) GN=prfB PE=3 SV=1 49 112 1.0E-08
sp|Q2YSH5|RF2_STAAB Peptide chain release factor 2 OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=prfB PE=3 SV=2 49 112 1.0E-08
sp|A6TZN3|RF2_STAA2 Peptide chain release factor 2 OS=Staphylococcus aureus (strain JH1) GN=prfB PE=3 SV=1 49 112 1.0E-08
sp|Q3K6W9|RF1_PSEPF Peptide chain release factor 1 OS=Pseudomonas fluorescens (strain Pf0-1) GN=prfA PE=3 SV=1 31 102 1.0E-08
sp|A6SXF4|RF2_JANMA Peptide chain release factor 2 OS=Janthinobacterium sp. (strain Marseille) GN=prfB PE=3 SV=1 50 103 1.0E-08
sp|Q1LTH5|RF1_BAUCH Peptide chain release factor 1 OS=Baumannia cicadellinicola subsp. Homalodisca coagulata GN=prfA PE=3 SV=1 36 100 1.0E-08
sp|B8G607|RF2_CHLAD Peptide chain release factor 2 OS=Chloroflexus aggregans (strain MD-66 / DSM 9485) GN=prfB PE=3 SV=1 34 100 1.0E-08
sp|A6UCF2|RF1_SINMW Peptide chain release factor 1 OS=Sinorhizobium medicae (strain WSM419) GN=prfA PE=3 SV=1 49 132 1.0E-08
sp|B1M766|RF1_METRJ Peptide chain release factor 1 OS=Methylobacterium radiotolerans (strain ATCC 27329 / DSM 1819 / JCM 2831) GN=prfA PE=3 SV=1 49 100 1.0E-08
sp|A9KHD4|RF1_CLOPH Peptide chain release factor 1 OS=Clostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg) GN=prfA PE=3 SV=1 49 103 1.0E-08
sp|Q6GIN7|RF2_STAAR Peptide chain release factor 2 OS=Staphylococcus aureus (strain MRSA252) GN=prfB PE=3 SV=1 49 110 1.0E-08
sp|P43918|RF2_HAEIN Peptide chain release factor 2 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=prfB PE=3 SV=1 50 180 1.0E-08
sp|B5YIQ7|RF1_THEYD Peptide chain release factor 1 OS=Thermodesulfovibrio yellowstonii (strain ATCC 51303 / DSM 11347 / YP87) GN=prfA PE=3 SV=1 52 103 1.0E-08
[Show less]

GO

GO Term Description Terminal node
GO:0006415 translational termination Yes
GO:0003747 translation release factor activity Yes
GO:0008135 translation factor activity, RNA binding No
GO:0005488 binding No
GO:0045182 translation regulator activity No
GO:0016043 cellular component organization No
GO:0032984 protein-containing complex disassembly No
GO:0008079 translation termination factor activity No
GO:0003674 molecular_function No
GO:0043933 protein-containing complex subunit organization No
GO:0003676 nucleic acid binding No
GO:0090079 translation regulator activity, nucleic acid binding No
GO:0097159 organic cyclic compound binding No
GO:0003723 RNA binding No
GO:0071840 cellular component organization or biogenesis No
GO:0008150 biological_process No
GO:1901363 heterocyclic compound binding No
GO:0022411 cellular component disassembly No
GO:0009987 cellular process No
GO:0043624 cellular protein complex disassembly No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 26 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|7079
MLPAALRLVPVRGFVARACFSVAAAVRGKGALPPRPKPPPESEIEESYLRGSGPGGQKINKTSSAVQLKHIPTGI
VVKSQATRSRSQNRTHAREILARRLDDLLHGQQSRSAVVGQVKKKRADSAAKKSRRKYRKLDEDKAAAAAGQHQE
PAATDGPRLQPAATDGPRRQPASTDKAADRPHNTAAAAAALGRDRSNHTPRS*
Coding >Hirsu2|7079
ATGCTTCCCGCCGCGCTCCGGCTCGTGCCCGTCCGCGGCTTCGTCGCCCGCGCCTGCTTCTCTGTCGCCGCTGCG
GTGCGCGGCAAGGGCGCGCTGCCGCCGCGGCCTAAGCCGCCGCCCGAGTCCGAGATCGAGGAGTCGTACCTTCGG
GGCAGCGGGCCCGGCGGCCAGAAGATTAACAAGACTAGCTCGGCCGTCCAGCTCAAGCACATCCCCACCGGCATC
GTCGTCAAGTCGCAGGCCACCCGCTCCCGCAGCCAGAACCGCACCCACGCCCGCGAGATCCTGGCCCGCCGGCTC
GACGACCTCCTCCACGGCCAGCAGAGCCGCTCCGCCGTCGTCGGCCAGGTCAAGAAGAAGCGGGCCGACAGCGCC
GCCAAGAAGAGCCGACGCAAGTACCGCAAGCTCGACGAGGACAAGGCCGCCGCCGCCGCCGGCCAACACCAAGAG
CCCGCCGCGACAGATGGCCCACGGCTTCAGCCTGCGGCGACGGATGGCCCACGGCGACAGCCTGCGTCGACGGAC
AAGGCGGCAGACAGGCCTCACAATACCGCTGCCGCTGCCGCTGCCCTTGGCCGAGACCGTAGCAATCACACACCA
CGATCCTAA
Transcript >Hirsu2|7079
ATGCTTCCCGCCGCGCTCCGGCTCGTGCCCGTCCGCGGCTTCGTCGCCCGCGCCTGCTTCTCTGTCGCCGCTGCG
GTGCGCGGCAAGGGCGCGCTGCCGCCGCGGCCTAAGCCGCCGCCCGAGTCCGAGATCGAGGAGTCGTACCTTCGG
GGCAGCGGGCCCGGCGGCCAGAAGATTAACAAGACTAGCTCGGCCGTCCAGCTCAAGCACATCCCCACCGGCATC
GTCGTCAAGTCGCAGGCCACCCGCTCCCGCAGCCAGAACCGCACCCACGCCCGCGAGATCCTGGCCCGCCGGCTC
GACGACCTCCTCCACGGCCAGCAGAGCCGCTCCGCCGTCGTCGGCCAGGTCAAGAAGAAGCGGGCCGACAGCGCC
GCCAAGAAGAGCCGACGCAAGTACCGCAAGCTCGACGAGGACAAGGCCGCCGCCGCCGCCGGCCAACACCAAGAG
CCCGCCGCGACAGATGGCCCACGGCTTCAGCCTGCGGCGACGGATGGCCCACGGCGACAGCCTGCGTCGACGGAC
AAGGCGGCAGACAGGCCTCACAATACCGCTGCCGCTGCCGCTGCCCTTGGCCGAGACCGTAGCAATCACACACCA
CGATCCTAA
Gene >Hirsu2|7079
ATGCTTCCCGCCGCGCTCCGGCTCGTGCCCGTCCGCGGCTTCGTCGCCCGCGCCTGCTTCTCTGTCGCCGCTGCG
GTGCGCGGCAAGGGCGCGCTGCCGCCGCGGCCTAAGCCGCCGCCCGAGTCCGAGATCGAGGAGTCGTACCTTCGG
GGCAGCGGGCCCGGCGGCCAGAAGATTGTGCCTCCTCCTCCTCCTCCCCCCTTTCTTCGCTACGCACCGTGACGG
AACCTGCGCTGACCTATCCTTTGTCCCCCTTCTCCCTTCTCTTCCCCGACGGCAGAACAAGACTAGCTCGGCCGT
CCAGCTCAAGCACATCCCCACCGGCATCGTCGTCAAGTCGCAGGCCACCCGCTCCCGCAGCCAGAACCGCACCCA
CGCCCGCGAGATCCTGGCCCGCCGGCTCGACGACCTCCTCCACGGCCAGCAGAGCCGCTCCGCCGTCGTCGGCCA
GGTCAAGAAGAAGCGGGCCGACAGCGCCGCCAAGAAGAGCCGACGCAAGTACCGCAAGCTCGACGAGGACAAGGC
CGCCGCCGCCGCCGGCCAACACCAAGAGCCCGCCGCGACAGATGGCCCACGGCTTCAGCCTGCGGCGACGGATGG
CCCACGGCGACAGCCTGCGTCGACGGACAAGGCGGCAGACAGGCCTCACAATACCGCTGCCGCTGCCGCTGCCCT
TGGCCGAGACCGTAGCAATCACACACCACGATCCTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail