Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|7067
Gene name
LocationContig_393:13291..13787
Strand+
Gene length (bp)496
Transcript length (bp)351
Coding sequence length (bp)351
Protein length (aa) 117

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02970 TBCA Tubulin binding cofactor A 2.5E-25 2 110

Swissprot hits

(None)

GO

GO Term Description Terminal node
GO:0007021 tubulin complex assembly Yes
GO:0048487 beta-tubulin binding Yes
GO:0007023 post-chaperonin tubulin folding pathway Yes
GO:0016043 cellular component organization No
GO:0006457 protein folding No
GO:0008092 cytoskeletal protein binding No
GO:0071840 cellular component organization or biogenesis No
GO:0005515 protein binding No
GO:0009987 cellular process No
GO:0043933 protein-containing complex organization No
GO:0005488 binding No
GO:0065003 protein-containing complex assembly No
GO:0015631 tubulin binding No
GO:0022607 cellular component assembly No
GO:0003674 molecular_function No
GO:0008150 biological_process No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm 0.6063 0.3693 0.0516 0.1945 0.2064 0.0038 0.13 0.143 0.1028 0.0637

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup3656
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1067
Ophiocordyceps australis map64 (Brazil) OphauB2|3943
Ophiocordyceps camponoti-floridani Ophcf2|00318
Ophiocordyceps camponoti-rufipedis Ophun1|3311
Ophiocordyceps kimflemingae Ophio5|1332
Ophiocordyceps subramaniannii Hirsu2|7067 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|7067
MPPPSPLAICTGSVQRLLKEEASYHAELAEQEAQVKLLEAEVASGGQASDDGNADFMLKQQRTAVEQTKAVFGPL
KKRLDEAVAALEDQVAASEETGTHAADLEQAKSTLQKAKAA*
Coding >Hirsu2|7067
ATGCCTCCTCCGTCGCCGCTCGCCATCTGCACCGGCTCCGTCCAGCGCCTGCTCAAGGAAGAGGCGTCGTACCAC
GCCGAGCTGGCGGAGCAAGAGGCGCAGGTCAAGCTCCTCGAGGCCGAGGTCGCGAGCGGCGGCCAGGCCAGCGAC
GACGGCAACGCCGACTTCATGCTGAAGCAGCAGCGAACCGCTGTGGAGCAGACCAAGGCCGTCTTCGGCCCGCTG
AAGAAGCGGCTGGACGAGGCGGTGGCCGCGCTCGAGGACCAGGTCGCCGCGAGCGAGGAGACGGGAACGCACGCG
GCCGACCTCGAACAAGCAAAGTCGACGCTGCAAAAGGCGAAGGCGGCATGA
Transcript >Hirsu2|7067
ATGCCTCCTCCGTCGCCGCTCGCCATCTGCACCGGCTCCGTCCAGCGCCTGCTCAAGGAAGAGGCGTCGTACCAC
GCCGAGCTGGCGGAGCAAGAGGCGCAGGTCAAGCTCCTCGAGGCCGAGGTCGCGAGCGGCGGCCAGGCCAGCGAC
GACGGCAACGCCGACTTCATGCTGAAGCAGCAGCGAACCGCTGTGGAGCAGACCAAGGCCGTCTTCGGCCCGCTG
AAGAAGCGGCTGGACGAGGCGGTGGCCGCGCTCGAGGACCAGGTCGCCGCGAGCGAGGAGACGGGAACGCACGCG
GCCGACCTCGAACAAGCAAAGTCGACGCTGCAAAAGGCGAAGGCGGCATGA
Gene >Hirsu2|7067
ATGCCTCCTCCGTCGCCGCTCGCCATCTGCACCGGCTCCGTCCAGCGCCTGCTCAAGGAAGAGGCGTCGTACCAC
GCCGAGCTGGCGGAGCAAGAGGCGCAGGTCAAGCTCCTCGAGGCCGAGGTCGCGAGCGGCGGCCAGGCCAGCGAC
GACGGCAACGCCGACTTCATGCTGAAGCAGCAGGTACAAACGCCACCCCGACTCGCCGCGTCCATGATTTCTTTT
TCTATCTTCTTCTTCTTCTTCTTCTTCTTCTTCGTTTTTTCTTCTTGCTTGCTTCTTGCCGCTTCTTTCGCTCGG
ATCGTTGCTGACCGTCGTCGGCTTGTAGCGAACCGCTGTGGAGCAGACCAAGGCCGTCTTCGGCCCGCTGAAGAA
GCGGCTGGACGAGGCGGTGGCCGCGCTCGAGGACCAGGTCGCCGCGAGCGAGGAGACGGGAACGCACGCGGCCGA
CCTCGAACAAGCAAAGTCGACGCTGCAAAAGGCGAAGGCGGCATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail