Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|7067
Gene name
LocationContig_393:13291..13787
Strand+
Gene length (bp)496
Transcript length (bp)351
Coding sequence length (bp)351
Protein length (aa) 117

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02970 TBCA Tubulin binding cofactor A 8.6E-24 7 96

Swissprot hits

(None)

GO

GO Term Description Terminal node
GO:0048487 beta-tubulin binding Yes
GO:0007023 post-chaperonin tubulin folding pathway Yes
GO:0007021 tubulin complex assembly Yes
GO:0022607 cellular component assembly No
GO:0005488 binding No
GO:0071840 cellular component organization or biogenesis No
GO:0065003 protein-containing complex assembly No
GO:0008092 cytoskeletal protein binding No
GO:0003674 molecular_function No
GO:0043933 protein-containing complex subunit organization No
GO:0016043 cellular component organization No
GO:0034622 cellular protein-containing complex assembly No
GO:0008150 biological_process No
GO:0005515 protein binding No
GO:0006457 protein folding No
GO:0015631 tubulin binding No
GO:0009987 cellular process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|7067
MPPPSPLAICTGSVQRLLKEEASYHAELAEQEAQVKLLEAEVASGGQASDDGNADFMLKQQRTAVEQTKAVFGPL
KKRLDEAVAALEDQVAASEETGTHAADLEQAKSTLQKAKAA*
Coding >Hirsu2|7067
ATGCCTCCTCCGTCGCCGCTCGCCATCTGCACCGGCTCCGTCCAGCGCCTGCTCAAGGAAGAGGCGTCGTACCAC
GCCGAGCTGGCGGAGCAAGAGGCGCAGGTCAAGCTCCTCGAGGCCGAGGTCGCGAGCGGCGGCCAGGCCAGCGAC
GACGGCAACGCCGACTTCATGCTGAAGCAGCAGCGAACCGCTGTGGAGCAGACCAAGGCCGTCTTCGGCCCGCTG
AAGAAGCGGCTGGACGAGGCGGTGGCCGCGCTCGAGGACCAGGTCGCCGCGAGCGAGGAGACGGGAACGCACGCG
GCCGACCTCGAACAAGCAAAGTCGACGCTGCAAAAGGCGAAGGCGGCATGA
Transcript >Hirsu2|7067
ATGCCTCCTCCGTCGCCGCTCGCCATCTGCACCGGCTCCGTCCAGCGCCTGCTCAAGGAAGAGGCGTCGTACCAC
GCCGAGCTGGCGGAGCAAGAGGCGCAGGTCAAGCTCCTCGAGGCCGAGGTCGCGAGCGGCGGCCAGGCCAGCGAC
GACGGCAACGCCGACTTCATGCTGAAGCAGCAGCGAACCGCTGTGGAGCAGACCAAGGCCGTCTTCGGCCCGCTG
AAGAAGCGGCTGGACGAGGCGGTGGCCGCGCTCGAGGACCAGGTCGCCGCGAGCGAGGAGACGGGAACGCACGCG
GCCGACCTCGAACAAGCAAAGTCGACGCTGCAAAAGGCGAAGGCGGCATGA
Gene >Hirsu2|7067
ATGCCTCCTCCGTCGCCGCTCGCCATCTGCACCGGCTCCGTCCAGCGCCTGCTCAAGGAAGAGGCGTCGTACCAC
GCCGAGCTGGCGGAGCAAGAGGCGCAGGTCAAGCTCCTCGAGGCCGAGGTCGCGAGCGGCGGCCAGGCCAGCGAC
GACGGCAACGCCGACTTCATGCTGAAGCAGCAGGTACAAACGCCACCCCGACTCGCCGCGTCCATGATTTCTTTT
TCTATCTTCTTCTTCTTCTTCTTCTTCTTCTTCGTTTTTTCTTCTTGCTTGCTTCTTGCCGCTTCTTTCGCTCGG
ATCGTTGCTGACCGTCGTCGGCTTGTAGCGAACCGCTGTGGAGCAGACCAAGGCCGTCTTCGGCCCGCTGAAGAA
GCGGCTGGACGAGGCGGTGGCCGCGCTCGAGGACCAGGTCGCCGCGAGCGAGGAGACGGGAACGCACGCGGCCGA
CCTCGAACAAGCAAAGTCGACGCTGCAAAAGGCGAAGGCGGCATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail