Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|7063
Gene name
LocationContig_392:19578..21018
Strand-
Gene length (bp)1440
Transcript length (bp)1239
Coding sequence length (bp)1239
Protein length (aa) 413

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01565 FAD_binding_4 FAD binding domain 8.8E-14 15 90
PF08031 BBE Berberine and berberine like 6.7E-06 376 406

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|D7UQ40|SOL5_ALTSO Bifunctional solanapyrone synthase OS=Alternaria solani GN=sol5 PE=1 SV=1 16 411 2.0E-31
sp|D4B1P2|A2372_ARTBC Uncharacterized FAD-linked oxidoreductase ARB_02372 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_02372 PE=1 SV=1 19 410 9.0E-31
sp|D4B1Z7|A2478_ARTBC Uncharacterized FAD-linked oxidoreductase ARB_02478 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_02478 PE=1 SV=1 30 120 8.0E-11
sp|P08159|HDNO_ARTOX 6-hydroxy-D-nicotine oxidase OS=Arthrobacter oxydans PE=1 SV=2 17 122 8.0E-10
sp|Q6Z955|CKX11_ORYSJ Cytokinin dehydrogenase 11 OS=Oryza sativa subsp. japonica GN=CKX11 PE=2 SV=1 6 117 4.0E-07
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|D7UQ40|SOL5_ALTSO Bifunctional solanapyrone synthase OS=Alternaria solani GN=sol5 PE=1 SV=1 16 411 2.0E-31
sp|D4B1P2|A2372_ARTBC Uncharacterized FAD-linked oxidoreductase ARB_02372 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_02372 PE=1 SV=1 19 410 9.0E-31
sp|D4B1Z7|A2478_ARTBC Uncharacterized FAD-linked oxidoreductase ARB_02478 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_02478 PE=1 SV=1 30 120 8.0E-11
sp|P08159|HDNO_ARTOX 6-hydroxy-D-nicotine oxidase OS=Arthrobacter oxydans PE=1 SV=2 17 122 8.0E-10
sp|Q6Z955|CKX11_ORYSJ Cytokinin dehydrogenase 11 OS=Oryza sativa subsp. japonica GN=CKX11 PE=2 SV=1 6 117 4.0E-07
sp|A3AVP1|CKX8_ORYSJ Cytokinin dehydrogenase 8 OS=Oryza sativa subsp. japonica GN=CKX8 PE=3 SV=1 21 114 8.0E-07
sp|A2XVN3|CKX8_ORYSI Cytokinin dehydrogenase 8 OS=Oryza sativa subsp. indica GN=CKX8 PE=3 SV=1 21 114 8.0E-07
sp|Q9FUJ2|CKX4_ARATH Cytokinin dehydrogenase 4 OS=Arabidopsis thaliana GN=CKX4 PE=1 SV=2 2 114 2.0E-06
sp|Q4ADV8|CKX2_ORYSJ Cytokinin dehydrogenase 2 OS=Oryza sativa subsp. japonica GN=CKX2 PE=2 SV=1 8 117 7.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016491 oxidoreductase activity Yes
GO:0055114 oxidation-reduction process Yes
GO:0050660 flavin adenine dinucleotide binding Yes
GO:1901265 nucleoside phosphate binding No
GO:0050662 coenzyme binding No
GO:0005488 binding No
GO:0003824 catalytic activity No
GO:0043168 anion binding No
GO:0003674 molecular_function No
GO:0097159 organic cyclic compound binding No
GO:0043167 ion binding No
GO:0000166 nucleotide binding No
GO:0036094 small molecule binding No
GO:0008150 biological_process No
GO:0048037 cofactor binding No
GO:1901363 heterocyclic compound binding No
GO:0008152 metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.5

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|7063
LLAFRPRARFVVPAPDGTTVDVGPGCKWEDVYAALQPLGKTAVGGRLGDVGVVGFLLGGGLSYLSAQHGLACDNV
VSFECVLADGTVVTASRTSHPDLFLALRGGGNQFAVVTRMTLRTHDVGDGGRVWGGIRTYAADQHAALLSAVSNF
TAANGRHPRAALIPNFNFLAGLGLNLPFAFFFFFYDGREPADGAFDAFDAIPHLTSGTATKTYAALTSEALGGDY
KGLRFQIRTGTFPNMPLPPMTAFLADHFRHIAAATAAGARADVLDLRLLTYAPQPLSRALVQASLDAGGGNALGL
VPEHGDRVWMEYDMAWANPLCDTKCPSFFRDTIDSARAIHENKYAGIAPTNYAEGDLSFLSYNPLFMNDAMADQK
VLQSYGEDNYQRLKAIHQKYDPDDFFSTRQGGFKFTP*
Coding >Hirsu2|7063
CTGCTGGCGTTCCGGCCGCGCGCGCGCTTCGTCGTCCCGGCCCCGGACGGCACCACCGTCGACGTCGGGCCCGGC
TGCAAGTGGGAGGACGTCTACGCCGCGCTGCAGCCGCTGGGCAAGACGGCCGTCGGCGGCCGTCTGGGCGACGTC
GGCGTCGTCGGATTTCTCCTCGGCGGCGGCCTCTCGTACCTGTCGGCGCAGCATGGCCTCGCCTGCGACAACGTG
GTCAGCTTCGAGTGCGTGCTGGCGGACGGCACGGTCGTGACGGCCAGCCGGACGTCGCACCCGGACCTGTTCCTC
GCCCTGCGCGGCGGCGGCAACCAGTTCGCCGTGGTGACGCGCATGACGCTGCGGACGCACGACGTCGGCGACGGC
GGCCGCGTCTGGGGCGGCATCCGGACCTACGCGGCCGACCAGCACGCGGCCCTGCTGTCGGCCGTGTCCAACTTC
ACGGCCGCCAACGGCCGGCATCCGCGCGCGGCCCTGATCCCCAACTTCAACTTCCTCGCCGGCCTCGGCCTCAAC
CTGCCCTTCGCCTTCTTCTTCTTCTTCTACGACGGCCGCGAGCCGGCCGACGGCGCCTTCGACGCCTTCGACGCC
ATCCCTCACCTCACCTCCGGCACCGCGACCAAGACGTACGCCGCCCTGACGAGCGAGGCCCTCGGCGGCGACTAC
AAGGGCCTGCGCTTCCAGATCCGCACCGGCACGTTCCCCAACATGCCGCTGCCGCCCATGACCGCCTTCCTGGCC
GACCACTTCCGTCACATCGCCGCCGCCACCGCCGCCGGCGCCCGGGCCGACGTCCTCGACCTCCGCCTGCTGACC
TACGCGCCCCAGCCGCTGTCCCGTGCCCTCGTCCAGGCCTCCCTCGACGCCGGCGGCGGCAACGCCCTCGGCCTC
GTGCCGGAGCACGGCGACCGGGTCTGGATGGAGTACGACATGGCCTGGGCGAACCCGCTGTGCGACACCAAGTGC
CCGTCCTTCTTCCGGGACACCATCGACTCGGCCCGCGCCATCCACGAGAACAAGTACGCCGGCATCGCCCCGACC
AACTACGCCGAGGGCGACTTGAGCTTTCTCAGCTATAACCCCCTCTTCATGAACGACGCCATGGCCGACCAGAAG
GTGCTGCAGAGCTACGGCGAGGACAACTATCAGAGGCTCAAGGCCATTCATCAGAAATACGATCCCGACGACTTC
TTCTCCACGCGGCAGGGCGGCTTCAAATTTACCCCATAA
Transcript >Hirsu2|7063
CTGCTGGCGTTCCGGCCGCGCGCGCGCTTCGTCGTCCCGGCCCCGGACGGCACCACCGTCGACGTCGGGCCCGGC
TGCAAGTGGGAGGACGTCTACGCCGCGCTGCAGCCGCTGGGCAAGACGGCCGTCGGCGGCCGTCTGGGCGACGTC
GGCGTCGTCGGATTTCTCCTCGGCGGCGGCCTCTCGTACCTGTCGGCGCAGCATGGCCTCGCCTGCGACAACGTG
GTCAGCTTCGAGTGCGTGCTGGCGGACGGCACGGTCGTGACGGCCAGCCGGACGTCGCACCCGGACCTGTTCCTC
GCCCTGCGCGGCGGCGGCAACCAGTTCGCCGTGGTGACGCGCATGACGCTGCGGACGCACGACGTCGGCGACGGC
GGCCGCGTCTGGGGCGGCATCCGGACCTACGCGGCCGACCAGCACGCGGCCCTGCTGTCGGCCGTGTCCAACTTC
ACGGCCGCCAACGGCCGGCATCCGCGCGCGGCCCTGATCCCCAACTTCAACTTCCTCGCCGGCCTCGGCCTCAAC
CTGCCCTTCGCCTTCTTCTTCTTCTTCTACGACGGCCGCGAGCCGGCCGACGGCGCCTTCGACGCCTTCGACGCC
ATCCCTCACCTCACCTCCGGCACCGCGACCAAGACGTACGCCGCCCTGACGAGCGAGGCCCTCGGCGGCGACTAC
AAGGGCCTGCGCTTCCAGATCCGCACCGGCACGTTCCCCAACATGCCGCTGCCGCCCATGACCGCCTTCCTGGCC
GACCACTTCCGTCACATCGCCGCCGCCACCGCCGCCGGCGCCCGGGCCGACGTCCTCGACCTCCGCCTGCTGACC
TACGCGCCCCAGCCGCTGTCCCGTGCCCTCGTCCAGGCCTCCCTCGACGCCGGCGGCGGCAACGCCCTCGGCCTC
GTGCCGGAGCACGGCGACCGGGTCTGGATGGAGTACGACATGGCCTGGGCGAACCCGCTGTGCGACACCAAGTGC
CCGTCCTTCTTCCGGGACACCATCGACTCGGCCCGCGCCATCCACGAGAACAAGTACGCCGGCATCGCCCCGACC
AACTACGCCGAGGGCGACTTGAGCTTTCTCAGCTATAACCCCCTCTTCATGAACGACGCCATGGCCGACCAGAAG
GTGCTGCAGAGCTACGGCGAGGACAACTATCAGAGGCTCAAGGCCATTCATCAGAAATACGATCCCGACGACTTC
TTCTCCACGCGGCAGGGCGGCTTCAAATTTACCCCATAA
Gene >Hirsu2|7063
CTGCTGGCGTTCCGGCCGCGCGCGCGCTTCGTCGTCCCGGCCCCGGACGGCACCACCGTCGACGTCGGGCCCGGC
TGCAAGTGGGAGGACGTCTACGCCGCGCTGCAGCCGCTGGGCAAGACGGCCGTCGGCGGCCGTCTGGGCGACGTC
GGCGTCGTCGGATTTCTCCTCGGCGGCGGCCTCTCGTACCTGTCGGCGCAGCATGTAAGTTGCTTTCCCGGCTCG
GCCCCGGCCTCCGTGGGTCCCCCGCGCCGGTCCGGGCCCGTGGATCCCGTCGCTCACACGTCCGGGCCCAGGGCC
TCGCCTGCGACAACGTGGTCAGCTTCGAGTGCGTGCTGGCGGACGGCACGGTCGTGACGGCCAGCCGGACGTCGC
ACCCGGACCTGTTCCTCGCCCTGCGCGGCGGCGGCAACCAGTTCGCCGTGGTGACGCGCATGACGCTGCGGACGC
ACGACGTCGGCGACGGCGGCCGCGTCTGGGGCGGCATCCGGACCTACGCGGCCGACCAGCACGCGGCCCTGCTGT
CGGCCGTGTCCAACTTCACGGCCGCCAACGGCCGGCATCCGCGCGCGGCCCTGATCCCCAACTTCAACTTCCTCG
CCGGCCTCGGCCTCAACCTGCCCTTCGCCTTCTTCTTCTTCTTCTACGACGGCCGCGAGCCGGCCGACGGCGCCT
TCGACGCCTTCGACGCCATCCCTCACCTCACCTCCGGCACCGCGACCAAGACGTACGCCGCCCTGACGAGCGAGG
CCCTCGGCGGCGACTACAAGGGCCTGCGCTTCCAGATCCGCACCGGCACGTTCCCCAACATGCCGCTGCCGCCCA
TGACCGCCTTCCTGGCCGACCACTTCCGTCACATCGCCGCCGCCACCGCCGCCGGCGCCCGGGCCGACGTCCTCG
ACCTCCGCCTGCTGACCTACGCGCCCCAGCCGCTGTCCCGTGCCCTCGTCCAGGCCTCCCTCGACGCCGGCGGCG
GCAACGCCCTCGGCCTCGTGCCGGAGCACGGCGACCGGGTCTGGATGGAGTACGACATGGCCTGGGCGAACCCGC
TGTGCGACACCAAGTGCCCGTCCTTCTTCCGGGACACCATCGACTCGGCCCGCGCCATCCACGAGAACAAGTACG
CCGGCATCGCCCCGACCAACTACGCCGAGGGCGACTTGAGCTTTCTCAGGTGCGTGTATCCCCTCTCCTGCCGTG
TAGCCTGCGTTATCACCGCCGTATATCCCACGAAACGCTCCCGTCCAGACCAAACCGGCTGCTGATGCCCTTCGG
ATTCGCAGCTATAACCCCCTCTTCATGAACGACGCCATGGCCGACCAGAAGGTGCTGCAGAGCTACGGCGAGGAC
AACTATCAGAGGCTCAAGGCCATTCATCAGAAATACGATCCCGACGACTTCTTCTCCACGCGGCAGGGCGGCTTC
AAATTTACCCCATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail