Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|7061
Gene name
LocationContig_392:12928..15387
Strand+
Gene length (bp)2459
Transcript length (bp)1716
Coding sequence length (bp)1716
Protein length (aa) 572

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01593 Amino_oxidase Flavin containing amine oxidoreductase 3.3E-55 91 557
PF13450 NAD_binding_8 NAD(P)-binding Rossmann-like domain 4.6E-15 86 151
PF01266 DAO FAD dependent oxidoreductase 1.0E-08 83 338
PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase 1.7E-07 59 126
PF00070 Pyr_redox Pyridine nucleotide-disulphide oxidoreductase 6.5E-06 83 119
PF00890 FAD_binding_2 FAD binding domain 2.3E-05 84 134

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q8H191|PAO4_ARATH Probable polyamine oxidase 4 OS=Arabidopsis thaliana GN=PAO4 PE=1 SV=1 80 552 6.0E-28
sp|Q9CAE3|FLD_ARATH Protein FLOWERING LOCUS D OS=Arabidopsis thaliana GN=FLD PE=1 SV=1 79 566 2.0E-25
sp|Q8VXV7|LDL1_ARATH Lysine-specific histone demethylase 1 homolog 1 OS=Arabidopsis thaliana GN=LDL1 PE=1 SV=1 82 550 1.0E-21
sp|P50264|FMS1_YEAST Polyamine oxidase FMS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FMS1 PE=1 SV=1 80 559 1.0E-21
sp|Q21988|AMX1_CAEEL Amine oxidase family member 1 OS=Caenorhabditis elegans GN=amx-1 PE=3 SV=3 81 550 2.0E-20
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q8H191|PAO4_ARATH Probable polyamine oxidase 4 OS=Arabidopsis thaliana GN=PAO4 PE=1 SV=1 80 552 6.0E-28
sp|Q9CAE3|FLD_ARATH Protein FLOWERING LOCUS D OS=Arabidopsis thaliana GN=FLD PE=1 SV=1 79 566 2.0E-25
sp|Q8VXV7|LDL1_ARATH Lysine-specific histone demethylase 1 homolog 1 OS=Arabidopsis thaliana GN=LDL1 PE=1 SV=1 82 550 1.0E-21
sp|P50264|FMS1_YEAST Polyamine oxidase FMS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FMS1 PE=1 SV=1 80 559 1.0E-21
sp|Q21988|AMX1_CAEEL Amine oxidase family member 1 OS=Caenorhabditis elegans GN=amx-1 PE=3 SV=3 81 550 2.0E-20
sp|Q9LYT1|PAO3_ARATH Polyamine oxidase 3 OS=Arabidopsis thaliana GN=PAO3 PE=1 SV=1 82 562 1.0E-18
sp|Q8NB78|KDM1B_HUMAN Lysine-specific histone demethylase 1B OS=Homo sapiens GN=KDM1B PE=1 SV=3 104 558 2.0E-18
sp|O64411|PAO_MAIZE Polyamine oxidase OS=Zea mays GN=PAO PE=1 SV=1 82 550 1.0E-17
sp|Q8CIG3|KDM1B_MOUSE Lysine-specific histone demethylase 1B OS=Mus musculus GN=Kdm1b PE=1 SV=1 104 558 2.0E-17
sp|Q9SU79|PAO5_ARATH Probable polyamine oxidase 5 OS=Arabidopsis thaliana GN=PAO5 PE=2 SV=1 79 561 2.0E-17
sp|P86810|OXLA_SIGCA L-amino-acid oxidase OS=Siganus canaliculatus PE=1 SV=2 58 535 3.0E-17
sp|Q99K82|SMOX_MOUSE Spermine oxidase OS=Mus musculus GN=Smox PE=1 SV=1 80 561 7.0E-17
sp|Q8C0L6|PAOX_MOUSE Peroxisomal N(1)-acetyl-spermine/spermidine oxidase OS=Mus musculus GN=Paox PE=1 SV=3 82 442 8.0E-17
sp|O96570|A37C_DROLE Protein anon-37Cs OS=Drosophila lebanonensis GN=anon-37Cs PE=3 SV=1 72 561 6.0E-16
sp|Q9NWM0|SMOX_HUMAN Spermine oxidase OS=Homo sapiens GN=SMOX PE=1 SV=1 80 561 7.0E-16
sp|Q01H90|LDL3_ORYSI Lysine-specific histone demethylase 1 homolog 3 OS=Oryza sativa subsp. indica GN=B0103C08-B0602B01.13 PE=3 SV=1 46 550 6.0E-15
sp|A8QL52|OXLA_BUNFA L-amino-acid oxidase OS=Bungarus fasciatus PE=1 SV=1 83 535 7.0E-15
sp|Q9LID0|LDL2_ARATH Lysine-specific histone demethylase 1 homolog 2 OS=Arabidopsis thaliana GN=LDL2 PE=2 SV=1 84 550 7.0E-15
sp|P18487|A37C_DROME Protein anon-37Cs OS=Drosophila melanogaster GN=anon-37Cs PE=2 SV=3 50 427 1.0E-14
sp|Q7XUR2|LDL3_ORYSJ Lysine-specific histone demethylase 1 homolog 3 OS=Oryza sativa subsp. japonica GN=Os04g0560300 PE=2 SV=2 46 550 2.0E-14
sp|O96566|A37C_DROSI Protein anon-37Cs (Fragment) OS=Drosophila simulans GN=anon-37Cs PE=3 SV=1 50 427 2.0E-14
sp|A8QL51|OXLA_BUNMU L-amino-acid oxidase OS=Bungarus multicinctus PE=2 SV=1 83 535 2.0E-14
sp|Q9SKX5|PAO2_ARATH Probable polyamine oxidase 2 OS=Arabidopsis thaliana GN=PAO2 PE=2 SV=1 96 563 4.0E-14
sp|Q6YYZ1|LDL2_ORYSJ Lysine-specific histone demethylase 1 homolog 2 OS=Oryza sativa subsp. japonica GN=Os08g0143400 PE=2 SV=1 100 550 1.0E-13
sp|Q6QHF9|PAOX_HUMAN Peroxisomal N(1)-acetyl-spermine/spermidine oxidase OS=Homo sapiens GN=PAOX PE=1 SV=3 109 534 1.0E-13
sp|Q865R1|PAOX_BOVIN Peroxisomal N(1)-acetyl-spermine/spermidine oxidase OS=Bos taurus GN=PAOX PE=1 SV=3 109 534 8.0E-13
sp|Q4JHE3|OXLA_OXYSC L-amino-acid oxidase OS=Oxyuranus scutellatus scutellatus PE=2 SV=1 83 385 3.0E-12
sp|Q9FNA2|PAO1_ARATH Polyamine oxidase 1 OS=Arabidopsis thaliana GN=PAO1 PE=1 SV=1 99 564 1.0E-11
sp|Q6Q2J0|AOFA_PIG Amine oxidase [flavin-containing] A OS=Sus scrofa GN=MAOA PE=2 SV=1 72 563 3.0E-11
sp|Q9XWP6|LSD1_CAEEL Probable lysine-specific histone demethylase 1 OS=Caenorhabditis elegans GN=spr-5 PE=1 SV=1 309 561 8.0E-11
sp|O60341|KDM1A_HUMAN Lysine-specific histone demethylase 1A OS=Homo sapiens GN=KDM1A PE=1 SV=2 84 178 3.0E-09
sp|Q9VW97|LSDA_DROME Possible lysine-specific histone demethylase 1 OS=Drosophila melanogaster GN=Su(var)3-3 PE=1 SV=1 84 180 3.0E-09
sp|Q6ZQ88|KDM1A_MOUSE Lysine-specific histone demethylase 1A OS=Mus musculus GN=Kdm1a PE=1 SV=2 84 178 3.0E-09
sp|P21397|AOFA_HUMAN Amine oxidase [flavin-containing] A OS=Homo sapiens GN=MAOA PE=1 SV=1 72 563 5.0E-08
sp|Q8BW75|AOFB_MOUSE Amine oxidase [flavin-containing] B OS=Mus musculus GN=Maob PE=1 SV=4 81 152 2.0E-07
sp|Q5RE60|AOFA_PONAB Amine oxidase [flavin-containing] A OS=Pongo abelii GN=MAOA PE=2 SV=1 72 563 2.0E-07
sp|P19643|AOFB_RAT Amine oxidase [flavin-containing] B OS=Rattus norvegicus GN=Maob PE=1 SV=3 81 152 3.0E-07
sp|Q5NU32|AOFA_HORSE Amine oxidase [flavin-containing] A OS=Equus caballus GN=MAOA PE=2 SV=1 71 166 3.0E-07
sp|F4JLS1|LDL3_ARATH Lysine-specific histone demethylase 1 homolog 3 OS=Arabidopsis thaliana GN=LDL3 PE=2 SV=1 267 559 4.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0016491 oxidoreductase activity Yes
GO:0055114 oxidation-reduction process Yes
GO:0008152 metabolic process No
GO:0008150 biological_process No
GO:0003674 molecular_function No
GO:0003824 catalytic activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 24 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|7061
LTSFLYQTPRRSPQTSRRPASWPGAAGQSEPVRPSHRKSSRIYQDLSSARLASLSALDCDRLLRTMDDAFAQSKA
DGPAAKPHVAVIGAGLSGLRCADVLLQRGFRVTIIEARDRVGGRLHQQRLANGHLADMGPNWIHGTSDNPILDLA
RQTKTAVSRWDANSHLFDESGALFPADEADKYANVMWDIIQDAFRHSNKSSIDIHSARSLADFFLDQVAQRFPEG
EPGFERKRSIVLQMSDMWGSFIGSPTSRQSLKFFWLEECIEGENLFCAGTYNKILEVVAQPALAAADILFNTKVQ
SISSRPGRGGESVRVQVVRQGADKPSILSFDQVVVTCPLGWLKRNLDAFEPPLTPRLVRAIESIGYGCLEKVYIS
FPKAFWLADGEGCRKVQGFIQWLSPDYAAHSNPNRWNQEAVELASLAPESAHPTLLFYIFGDQSRHLTASVAELK
DQAHRNRFLCDFFKPYYSRLPQYSETSDDCQPSGCLATEWVRDEFAGFGSYSNFQVGLEEGDEDIKAMREGLPDR
RVWFAGEHTAPFVALGTATGAYWSGESVGRRIADSYGQSRGHGRAE*
Coding >Hirsu2|7061
CTGACCAGCTTCCTCTACCAGACGCCTCGGCGATCCCCTCAGACAAGTCGCCGGCCAGCATCGTGGCCCGGCGCC
GCCGGCCAGTCAGAGCCAGTCCGCCCCTCGCACCGCAAAAGCTCGAGAATCTACCAAGACCTCAGCTCGGCCCGG
CTCGCCAGCCTCTCTGCTCTGGATTGCGACCGCCTCCTTCGCACCATGGATGATGCCTTTGCTCAGTCCAAGGCC
GACGGCCCGGCTGCGAAGCCACATGTGGCCGTCATCGGCGCCGGGCTTTCTGGCCTCCGCTGTGCCGACGTCCTG
CTGCAGCGCGGCTTCCGCGTCACCATCATCGAGGCCAGGGACCGAGTCGGAGGCCGCCTGCATCAGCAACGCCTC
GCCAACGGCCACCTGGCCGACATGGGGCCCAACTGGATCCACGGGACCTCGGACAACCCCATCCTCGACCTGGCC
CGACAGACAAAGACTGCCGTGAGCCGCTGGGACGCCAATTCTCACCTCTTCGACGAGTCCGGCGCCTTGTTCCCG
GCCGATGAGGCCGACAAGTACGCTAACGTCATGTGGGACATCATACAGGACGCCTTCAGGCATTCCAACAAGTCC
AGCATCGACATCCATAGCGCCAGGAGCTTAGCCGACTTCTTCCTCGACCAGGTGGCCCAGAGGTTTCCGGAAGGC
GAGCCCGGCTTTGAGCGGAAAAGGAGCATCGTCCTGCAGATGTCCGACATGTGGGGCTCCTTCATCGGCAGCCCG
ACAAGCCGCCAAAGCCTCAAGTTCTTCTGGCTCGAGGAGTGCATTGAAGGAGAGAACCTGTTTTGTGCCGGCACT
TACAACAAGATCCTGGAGGTTGTCGCACAGCCGGCGCTCGCTGCGGCTGACATTCTATTCAACACCAAGGTGCAG
AGCATATCTTCCCGTCCGGGACGCGGAGGCGAATCGGTACGAGTCCAGGTTGTCAGACAGGGTGCTGATAAGCCG
TCGATATTATCATTCGACCAAGTCGTCGTCACCTGCCCGCTCGGCTGGCTGAAGCGAAACCTTGATGCCTTTGAG
CCGCCTCTGACTCCGCGCCTGGTCCGAGCCATCGAATCCATCGGCTACGGCTGTCTCGAAAAGGTCTATATCAGC
TTTCCCAAGGCCTTCTGGCTTGCGGACGGGGAGGGCTGTCGCAAGGTTCAGGGATTCATCCAGTGGCTTTCGCCG
GATTACGCCGCCCACTCGAATCCCAACCGATGGAACCAAGAAGCTGTCGAGCTGGCCAGCCTCGCGCCCGAGTCG
GCCCATCCAACGCTGCTCTTTTACATCTTCGGAGACCAGTCTAGGCACCTGACGGCCTCGGTGGCCGAGTTGAAA
GATCAAGCCCACCGGAACCGGTTTTTGTGCGACTTTTTCAAGCCGTATTACTCGCGGTTACCACAGTACTCGGAG
ACATCGGACGACTGCCAGCCCTCGGGCTGCCTGGCCACCGAGTGGGTGCGCGACGAGTTTGCCGGGTTCGGATCC
TACAGCAACTTCCAGGTCGGCCTAGAAGAGGGCGACGAGGACATCAAGGCAATGAGAGAAGGCCTTCCGGATCGC
CGGGTCTGGTTCGCGGGCGAGCACACAGCGCCCTTTGTGGCTCTGGGAACTGCCACGGGGGCCTACTGGAGCGGC
GAGTCGGTGGGCAGGCGGATAGCCGATTCCTACGGGCAGTCACGGGGCCACGGGAGAGCCGAGTAG
Transcript >Hirsu2|7061
CTGACCAGCTTCCTCTACCAGACGCCTCGGCGATCCCCTCAGACAAGTCGCCGGCCAGCATCGTGGCCCGGCGCC
GCCGGCCAGTCAGAGCCAGTCCGCCCCTCGCACCGCAAAAGCTCGAGAATCTACCAAGACCTCAGCTCGGCCCGG
CTCGCCAGCCTCTCTGCTCTGGATTGCGACCGCCTCCTTCGCACCATGGATGATGCCTTTGCTCAGTCCAAGGCC
GACGGCCCGGCTGCGAAGCCACATGTGGCCGTCATCGGCGCCGGGCTTTCTGGCCTCCGCTGTGCCGACGTCCTG
CTGCAGCGCGGCTTCCGCGTCACCATCATCGAGGCCAGGGACCGAGTCGGAGGCCGCCTGCATCAGCAACGCCTC
GCCAACGGCCACCTGGCCGACATGGGGCCCAACTGGATCCACGGGACCTCGGACAACCCCATCCTCGACCTGGCC
CGACAGACAAAGACTGCCGTGAGCCGCTGGGACGCCAATTCTCACCTCTTCGACGAGTCCGGCGCCTTGTTCCCG
GCCGATGAGGCCGACAAGTACGCTAACGTCATGTGGGACATCATACAGGACGCCTTCAGGCATTCCAACAAGTCC
AGCATCGACATCCATAGCGCCAGGAGCTTAGCCGACTTCTTCCTCGACCAGGTGGCCCAGAGGTTTCCGGAAGGC
GAGCCCGGCTTTGAGCGGAAAAGGAGCATCGTCCTGCAGATGTCCGACATGTGGGGCTCCTTCATCGGCAGCCCG
ACAAGCCGCCAAAGCCTCAAGTTCTTCTGGCTCGAGGAGTGCATTGAAGGAGAGAACCTGTTTTGTGCCGGCACT
TACAACAAGATCCTGGAGGTTGTCGCACAGCCGGCGCTCGCTGCGGCTGACATTCTATTCAACACCAAGGTGCAG
AGCATATCTTCCCGTCCGGGACGCGGAGGCGAATCGGTACGAGTCCAGGTTGTCAGACAGGGTGCTGATAAGCCG
TCGATATTATCATTCGACCAAGTCGTCGTCACCTGCCCGCTCGGCTGGCTGAAGCGAAACCTTGATGCCTTTGAG
CCGCCTCTGACTCCGCGCCTGGTCCGAGCCATCGAATCCATCGGCTACGGCTGTCTCGAAAAGGTCTATATCAGC
TTTCCCAAGGCCTTCTGGCTTGCGGACGGGGAGGGCTGTCGCAAGGTTCAGGGATTCATCCAGTGGCTTTCGCCG
GATTACGCCGCCCACTCGAATCCCAACCGATGGAACCAAGAAGCTGTCGAGCTGGCCAGCCTCGCGCCCGAGTCG
GCCCATCCAACGCTGCTCTTTTACATCTTCGGAGACCAGTCTAGGCACCTGACGGCCTCGGTGGCCGAGTTGAAA
GATCAAGCCCACCGGAACCGGTTTTTGTGCGACTTTTTCAAGCCGTATTACTCGCGGTTACCACAGTACTCGGAG
ACATCGGACGACTGCCAGCCCTCGGGCTGCCTGGCCACCGAGTGGGTGCGCGACGAGTTTGCCGGGTTCGGATCC
TACAGCAACTTCCAGGTCGGCCTAGAAGAGGGCGACGAGGACATCAAGGCAATGAGAGAAGGCCTTCCGGATCGC
CGGGTCTGGTTCGCGGGCGAGCACACAGCGCCCTTTGTGGCTCTGGGAACTGCCACGGGGGCCTACTGGAGCGGC
GAGTCGGTGGGCAGGCGGATAGCCGATTCCTACGGGCAGTCACGGGGCCACGGGAGAGCCGAGTAG
Gene >Hirsu2|7061
CTGACCAGCTTCCTCTACCAGACGCCTCGGCGATCCCCTCAGACAAGGTTCGTGCAGCTCGTCCGCCCGCCATCG
ACCGAGAGCGGCCTCCGTCTAATCAGCGCGCGCGGCCTCGTCCAATGCTGCCAATCGGAATCCAGTCGCCGGCCA
GCATCGTGGCCCGGCGCCGCCGGCCAGTCAGAGCCAGTCCGGTCCGTCAGCTTTAAGCCCTCCCCCCCTTTGCGT
CCCTTATCAGCGTCCTGCCCGTCCCGTCTCCTCCCTCCCGGCCCTCCTCTTCTCCTCACCTTCATCCTCTCCGTT
CGCCGTCGTCGCCCTCCGCAGCTCGTCCGGACGCGTCGTCGTCGTCCTCCGCCATACCATGGATGCTTACTCGAT
GTGCTCCACCAGCCCCTCGCACCGCAAAAGCTCGAGAATCTACCAAGACCTCAGCTCGGCCCGGCTCGCCAGCCT
CTCTGCTCTGGATTGCGACCGCCTCCTTCGCACCATGGATGATGCCTTTGCTCAGGTATTTGCCGTCAGCGTCCT
CGCACCCGTTCTGCCTGCAGCTGCCGCGCCACCGCCCGTCTGGACGTGGACGGATCATGCCTGTTGCGAGTCTAT
CCTGTGCTCCATCGACGCCGCCGAGGCACTCCCCGCTTACGTGTCCCCCCGATGAGCAGTCCAAGGCCGACGGCC
CGGCTGCGAAGCCACATGTGGCCGTCATCGGCGCCGGGCTTTCTGGCCTCCGCTGTGCCGACGTCCTGCTGCAGC
GCGGCTTCCGCGTCACCATCATCGAGGCCAGGGACCGAGTCGGAGGCCGCCTGCATCAGCAACGCCTCGCCAACG
GCCACCTGGCCGACATGGGGCCCAACTGGATCCACGGGACCTCGGACAACCCCATCCTCGACCTGGCCCGACAGA
CAAAGACTGCCGTGAGCCGCTGGGACGCCAATTCTCACCTCTTCGACGAGTCCGGCGCCTTGTTCCCGGCCGATG
AGGCCGACAAGTACGCTAACGTCATGTGGGACATCATACAGGACGCCTTCAGGCATTCCAACAAGTCCAGCATCG
ACATCCATAGCGCCAGGAGCTTAGCCGACTTCTTCCTCGACCAGGTGGCCCAGAGGTTTCCGGAAGGCGAGCCCG
GCTTTGAGCGGAAAAGGAGCATCGTCCTGCAGATGTCCGACATGTGGGGCTCCTTCATCGGCAGCCCGACAAGCC
GCCAAAGCCTCAAGTTCTTCTGGCTCGAGGAGTGCATTGAAGGAGGCAAGCCATGACCCGCCATGCCCGCCACCG
TCCCAAGATGTCGCCCCTTTCCACTTCCTCCTCCTCCTCTTCTTGTCCCCTCTCCTCTCCTCCCCACTCCCCATG
CCTCCCTCTCGGCTTTCTCGCAGGGACGAGGAGGAGGGGGCAGACTTGGCTTCGGGAATCAGGACCATGGCACGC
TAACACGTACAACGCCCTCTCCTGCCTCGGTCAGAGAACCTGTTTTGTGCCGGCACTTACAACAAGATCCTGGAG
GTTGTCGCACAGCCGGCGCTCGCTGCGGCTGACATTCTATTCAACACCAAGGTGCAGAGCATATCTTCCCGTCCG
GGACGCGGAGGCGAATCGGTACGAGTCCAGGTTGTCAGACAGGGTGCTGATAAGCCGTCGATATTATCATTCGAC
CAAGTCGTCGTCACCTGCCCGCTCGGCTGGCTGAAGCGAAACCTTGATGCCTTTGAGCCGCCTCTGACTCCGCGC
CTGGTCCGAGCCATCGAATCCATCGGCTACGGCTGTCTCGAAAAGGCAAGACCGGCGTCCCTTGTCATTGGAGTC
CGGGTCTTGGTCATTGTCCCGCTGACGTGACTGATGTTCCGCGCTTCCCCGCTCAGGTCTATATCAGCTTTCCCA
AGGCCTTCTGGCTTGCGGACGGGGAGGGCTGTCGCAAGGTTCAGGGATTCATCCAGTGGCTTTCGCCGGATTACG
CCGCCCACTCGAATCCCAACCGATGGAACCAAGAAGCTGTCGAGCTGGCCAGCCTCGCGCCCGAGTCGGCCCATC
CAACGCTGCTCTTTTACATCTTCGGAGACCAGTCTAGGCACCTGACGGCCTCGGTGGCCGAGTTGAAAGATCAAG
CCCACCGGAACCGGTTTTTGTGCGACTTTTTCAAGCCGTATTACTCGCGGTTACCACAGTACTCGGAGACATCGG
ACGACTGCCAGCCCTCGGGCTGCCTGGCCACCGAGTGGGTGCGCGACGAGTTTGCCGGGTTCGGATCCTACAGCA
ACTTCCAGGTCGGCCTAGAAGAGGGCGACGAGGACATCAAGGCAATGAGAGAAGGCCTTCCGGATCGCCGGGTCT
GGTTCGCGGGCGAGCACACAGCGCCCTTTGTGGCTCTGGGAACTGCCACGGGGGCCTACTGGAGCGGCGAGTCGG
TGGGCAGGCGGATAGCCGATTCCTACGGGCAGTCACGGGGCCACGGGAGAGCCGAGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail