Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|7056
Gene name
LocationContig_391:11738..12773
Strand-
Gene length (bp)1035
Transcript length (bp)1035
Coding sequence length (bp)1035
Protein length (aa) 345

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus Nuclear localization signal 0.3343 0.9386 0.3246 0.0298 0.074 0.0054 0.0198 0.0217 0.0072 0.0256

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup6063
Change Orthofinder run
Species Protein ID
Ophiocordyceps subramaniannii Hirsu2|2342
Ophiocordyceps subramaniannii Hirsu2|7056 (this protein)
Ophiocordyceps subramaniannii Hirsu2|9624

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|7056
MQTASRHSISVAIWDFRSMNTIRISLGPNQSLNRNPILVMMSLTLSLATYEADRVMPDETDDDETKEPEPRASAF
VSAAQHAQYAYKINEAVSHWLYVIRAAPYMFVNDEVEDEVIAPGGIPLWLVAGWLYVPFEWDILPNNSQVLAHAD
YQPNPAYRGNNLEPGSTLTPARPADWDPEHGRDSAVRFMNQEGVGSVVGWTGRFPLPFESSPNVPLDSCPERYAQ
QCRAGPSRRRNSTWSDHEDDYEPPHKKYRPGSSPIPLSEIDFARVNVPEDALRRLRQGHQTEIDCQLLANELLQI
MPQSFFGKRAESLKDREAGGKARPHPRVKNTSLAEQGTNDPILI*
Coding >Hirsu2|7056
ATGCAAACAGCGAGCAGGCATTCGATCTCAGTCGCCATATGGGATTTCCGGAGCATGAACACGATCCGGATCAGT
CTGGGTCCGAATCAGAGCCTGAATCGGAACCCGATTCTTGTAATGATGAGCCTGACCCTCTCTCTGGCTACATAC
GAGGCTGACCGTGTTATGCCAGATGAAACGGATGATGACGAGACCAAGGAACCGGAACCAAGGGCTTCTGCTTTT
GTGTCAGCAGCGCAACACGCACAATACGCATACAAGATAAACGAGGCTGTAAGCCACTGGCTCTATGTCATCCGC
GCCGCACCTTACATGTTCGTTAATGACGAGGTCGAGGATGAAGTCATTGCACCAGGAGGCATCCCTCTATGGCTT
GTGGCTGGGTGGTTATACGTGCCATTCGAGTGGGACATTCTGCCCAACAATTCGCAAGTCCTGGCACATGCAGAC
TACCAACCCAATCCTGCTTACCGGGGCAATAATTTGGAACCTGGAAGCACACTTACCCCTGCGAGGCCAGCAGAC
TGGGACCCCGAGCATGGCAGAGATTCAGCCGTGAGGTTTATGAATCAGGAGGGGGTCGGGAGCGTTGTCGGTTGG
ACCGGCAGATTCCCGCTGCCGTTCGAGAGTTCCCCGAACGTCCCGCTCGACTCGTGCCCTGAGAGATATGCGCAG
CAGTGCCGGGCTGGTCCCTCTAGGAGGCGCAACAGTACCTGGAGCGACCACGAGGATGATTACGAGCCGCCTCAC
AAGAAGTATCGGCCAGGGAGCAGCCCTATTCCCCTATCCGAAATCGACTTTGCCCGGGTGAACGTACCCGAGGAC
GCCCTGCGGCGCCTGAGACAGGGACATCAAACCGAGATTGATTGCCAACTGTTGGCAAATGAGCTCCTCCAGATC
ATGCCACAAAGCTTCTTTGGCAAGCGAGCCGAGTCGCTCAAAGATCGCGAGGCCGGAGGTAAAGCGCGCCCTCAC
CCACGCGTCAAGAACACATCACTTGCCGAGCAAGGAACCAATGATCCGATATTGATCTAA
Transcript >Hirsu2|7056
ATGCAAACAGCGAGCAGGCATTCGATCTCAGTCGCCATATGGGATTTCCGGAGCATGAACACGATCCGGATCAGT
CTGGGTCCGAATCAGAGCCTGAATCGGAACCCGATTCTTGTAATGATGAGCCTGACCCTCTCTCTGGCTACATAC
GAGGCTGACCGTGTTATGCCAGATGAAACGGATGATGACGAGACCAAGGAACCGGAACCAAGGGCTTCTGCTTTT
GTGTCAGCAGCGCAACACGCACAATACGCATACAAGATAAACGAGGCTGTAAGCCACTGGCTCTATGTCATCCGC
GCCGCACCTTACATGTTCGTTAATGACGAGGTCGAGGATGAAGTCATTGCACCAGGAGGCATCCCTCTATGGCTT
GTGGCTGGGTGGTTATACGTGCCATTCGAGTGGGACATTCTGCCCAACAATTCGCAAGTCCTGGCACATGCAGAC
TACCAACCCAATCCTGCTTACCGGGGCAATAATTTGGAACCTGGAAGCACACTTACCCCTGCGAGGCCAGCAGAC
TGGGACCCCGAGCATGGCAGAGATTCAGCCGTGAGGTTTATGAATCAGGAGGGGGTCGGGAGCGTTGTCGGTTGG
ACCGGCAGATTCCCGCTGCCGTTCGAGAGTTCCCCGAACGTCCCGCTCGACTCGTGCCCTGAGAGATATGCGCAG
CAGTGCCGGGCTGGTCCCTCTAGGAGGCGCAACAGTACCTGGAGCGACCACGAGGATGATTACGAGCCGCCTCAC
AAGAAGTATCGGCCAGGGAGCAGCCCTATTCCCCTATCCGAAATCGACTTTGCCCGGGTGAACGTACCCGAGGAC
GCCCTGCGGCGCCTGAGACAGGGACATCAAACCGAGATTGATTGCCAACTGTTGGCAAATGAGCTCCTCCAGATC
ATGCCACAAAGCTTCTTTGGCAAGCGAGCCGAGTCGCTCAAAGATCGCGAGGCCGGAGGTAAAGCGCGCCCTCAC
CCACGCGTCAAGAACACATCACTTGCCGAGCAAGGAACCAATGATCCGATATTGATCTAA
Gene >Hirsu2|7056
ATGCAAACAGCGAGCAGGCATTCGATCTCAGTCGCCATATGGGATTTCCGGAGCATGAACACGATCCGGATCAGT
CTGGGTCCGAATCAGAGCCTGAATCGGAACCCGATTCTTGTAATGATGAGCCTGACCCTCTCTCTGGCTACATAC
GAGGCTGACCGTGTTATGCCAGATGAAACGGATGATGACGAGACCAAGGAACCGGAACCAAGGGCTTCTGCTTTT
GTGTCAGCAGCGCAACACGCACAATACGCATACAAGATAAACGAGGCTGTAAGCCACTGGCTCTATGTCATCCGC
GCCGCACCTTACATGTTCGTTAATGACGAGGTCGAGGATGAAGTCATTGCACCAGGAGGCATCCCTCTATGGCTT
GTGGCTGGGTGGTTATACGTGCCATTCGAGTGGGACATTCTGCCCAACAATTCGCAAGTCCTGGCACATGCAGAC
TACCAACCCAATCCTGCTTACCGGGGCAATAATTTGGAACCTGGAAGCACACTTACCCCTGCGAGGCCAGCAGAC
TGGGACCCCGAGCATGGCAGAGATTCAGCCGTGAGGTTTATGAATCAGGAGGGGGTCGGGAGCGTTGTCGGTTGG
ACCGGCAGATTCCCGCTGCCGTTCGAGAGTTCCCCGAACGTCCCGCTCGACTCGTGCCCTGAGAGATATGCGCAG
CAGTGCCGGGCTGGTCCCTCTAGGAGGCGCAACAGTACCTGGAGCGACCACGAGGATGATTACGAGCCGCCTCAC
AAGAAGTATCGGCCAGGGAGCAGCCCTATTCCCCTATCCGAAATCGACTTTGCCCGGGTGAACGTACCCGAGGAC
GCCCTGCGGCGCCTGAGACAGGGACATCAAACCGAGATTGATTGCCAACTGTTGGCAAATGAGCTCCTCCAGATC
ATGCCACAAAGCTTCTTTGGCAAGCGAGCCGAGTCGCTCAAAGATCGCGAGGCCGGAGGTAAAGCGCGCCCTCAC
CCACGCGTCAAGAACACATCACTTGCCGAGCAAGGAACCAATGATCCGATATTGATCTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail