Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|7055
Gene name
LocationContig_391:9914..11612
Strand-
Gene length (bp)1698
Transcript length (bp)1452
Coding sequence length (bp)1452
Protein length (aa) 484

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm 0.5554 0.3161 0.6133 0.1355 0.2408 0.0447 0.0491 0.16 0.1332 0.0058

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup107
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3896
Ophiocordyceps australis 1348a (Ghana) OphauG2|7079
Ophiocordyceps australis map64 (Brazil) OphauB2|462
Ophiocordyceps australis map64 (Brazil) OphauB2|5003
Ophiocordyceps australis map64 (Brazil) OphauB2|82
Ophiocordyceps subramaniannii Hirsu2|10294
Ophiocordyceps subramaniannii Hirsu2|10486
Ophiocordyceps subramaniannii Hirsu2|138
Ophiocordyceps subramaniannii Hirsu2|3043
Ophiocordyceps subramaniannii Hirsu2|541
Ophiocordyceps subramaniannii Hirsu2|6468
Ophiocordyceps subramaniannii Hirsu2|7033
Ophiocordyceps subramaniannii Hirsu2|7055 (this protein)
Ophiocordyceps subramaniannii Hirsu2|7134
Ophiocordyceps subramaniannii Hirsu2|8285

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|7055
MMPAAHEADVAPAIHGCQAFNKITVWLQIAGDSGDGTWSQIYMSFGNQESQLIKIADGPHAGDCSHRNIPLQAAY
GTPVVPVDLVTQVRIWDVSGDSTMAFLAGADAWVIESLRIDAQCSNLPKTLSYQSSTMRREVAHDKLHVDTPTPV
FTTEPIKPEDWIVPRDVAPSCRNDLLDTSLTVASTQCTDLEELKLGIELGHYRYQGTWDTLLLAFRDTDEEHVIA
SGPSPGFHEWQNIDLMRTFNRPTVALDHIKQVQIYQNRTSRWGGDEWTLQGIKLKGRCTGSLTEIELDKFASVNL
DTPGADTQWYQAKRVWKGRIAPEKDWAVLQDCRHFDRLTVDFHQRGAVEAAPEDDLFVRLSYTGAHGEVRVADMP
SPGQNRVDLKAVFGSDTVAVDDIRHFDVLSRAREAAAADAGVPVAGVTFRGRCAGPFKKEFIADKYKEFHDWFGS
DENALLFRHSIALEDWHLLDPVTKQRIKADREF*
Coding >Hirsu2|7055
ATGATGCCGGCAGCTCATGAAGCTGACGTCGCTCCAGCGATCCACGGGTGTCAAGCTTTCAACAAGATTACCGTT
TGGCTGCAGATCGCCGGCGACTCCGGCGACGGAACTTGGTCTCAAATATACATGTCTTTCGGGAACCAGGAGTCC
CAGCTCATCAAGATCGCGGACGGTCCTCACGCCGGCGACTGCAGCCATCGGAACATCCCCCTCCAAGCTGCCTAC
GGGACTCCCGTCGTACCTGTCGATCTTGTCACTCAGGTGAGAATCTGGGACGTTTCCGGAGACAGCACCATGGCC
TTTCTTGCAGGAGCAGACGCATGGGTGATTGAGAGCTTGCGGATCGACGCGCAATGCTCGAATCTACCCAAGACG
CTCTCGTATCAGTCCTCGACGATGAGGAGAGAAGTCGCTCACGATAAGCTGCATGTTGATACACCGACCCCCGTC
TTCACCACCGAACCGATCAAGCCTGAGGACTGGATTGTCCCCCGGGACGTGGCCCCGTCCTGCAGGAATGACCTG
TTAGACACGTCCCTGACCGTGGCATCAACGCAATGCACGGACTTGGAAGAGCTCAAATTGGGCATAGAGCTCGGC
CATTACAGATACCAAGGGACCTGGGATACCCTGCTTCTCGCCTTTCGGGACACGGACGAGGAACACGTCATTGCG
TCCGGCCCCAGCCCCGGCTTTCACGAGTGGCAGAACATCGACCTAATGAGGACGTTCAACCGGCCGACGGTCGCA
CTCGACCACATCAAGCAGGTCCAGATCTACCAGAACCGCACCAGCCGCTGGGGAGGAGACGAGTGGACTCTTCAA
GGCATCAAGCTGAAGGGGCGATGCACCGGCTCGCTCACCGAGATCGAGCTCGACAAGTTCGCATCGGTCAACCTC
GACACGCCGGGGGCCGATACGCAATGGTACCAGGCCAAGCGGGTTTGGAAGGGCAGGATCGCTCCGGAGAAGGAC
TGGGCCGTGCTGCAGGACTGCAGACATTTCGACCGCCTCACAGTAGACTTCCACCAGAGGGGCGCTGTCGAGGCC
GCACCCGAGGACGATTTGTTCGTCAGACTCTCATACACTGGCGCACATGGCGAAGTGCGCGTCGCGGACATGCCC
AGCCCCGGACAAAATAGGGTGGACTTGAAGGCTGTTTTCGGGTCGGACACGGTTGCCGTCGACGACATCAGGCAC
TTCGACGTTCTTTCTCGCGCTCGCGAGGCCGCAGCGGCCGATGCGGGCGTTCCAGTAGCCGGCGTCACGTTCAGG
GGTCGATGCGCTGGCCCTTTCAAGAAGGAGTTCATCGCAGACAAGTATAAGGAGTTTCACGATTGGTTCGGCAGC
GACGAGAATGCACTGTTGTTCAGACACAGCATCGCCTTGGAAGACTGGCATTTGCTGGATCCAGTGACGAAGCAG
AGAATCAAGGCCGACCGGGAATTTTGA
Transcript >Hirsu2|7055
ATGATGCCGGCAGCTCATGAAGCTGACGTCGCTCCAGCGATCCACGGGTGTCAAGCTTTCAACAAGATTACCGTT
TGGCTGCAGATCGCCGGCGACTCCGGCGACGGAACTTGGTCTCAAATATACATGTCTTTCGGGAACCAGGAGTCC
CAGCTCATCAAGATCGCGGACGGTCCTCACGCCGGCGACTGCAGCCATCGGAACATCCCCCTCCAAGCTGCCTAC
GGGACTCCCGTCGTACCTGTCGATCTTGTCACTCAGGTGAGAATCTGGGACGTTTCCGGAGACAGCACCATGGCC
TTTCTTGCAGGAGCAGACGCATGGGTGATTGAGAGCTTGCGGATCGACGCGCAATGCTCGAATCTACCCAAGACG
CTCTCGTATCAGTCCTCGACGATGAGGAGAGAAGTCGCTCACGATAAGCTGCATGTTGATACACCGACCCCCGTC
TTCACCACCGAACCGATCAAGCCTGAGGACTGGATTGTCCCCCGGGACGTGGCCCCGTCCTGCAGGAATGACCTG
TTAGACACGTCCCTGACCGTGGCATCAACGCAATGCACGGACTTGGAAGAGCTCAAATTGGGCATAGAGCTCGGC
CATTACAGATACCAAGGGACCTGGGATACCCTGCTTCTCGCCTTTCGGGACACGGACGAGGAACACGTCATTGCG
TCCGGCCCCAGCCCCGGCTTTCACGAGTGGCAGAACATCGACCTAATGAGGACGTTCAACCGGCCGACGGTCGCA
CTCGACCACATCAAGCAGGTCCAGATCTACCAGAACCGCACCAGCCGCTGGGGAGGAGACGAGTGGACTCTTCAA
GGCATCAAGCTGAAGGGGCGATGCACCGGCTCGCTCACCGAGATCGAGCTCGACAAGTTCGCATCGGTCAACCTC
GACACGCCGGGGGCCGATACGCAATGGTACCAGGCCAAGCGGGTTTGGAAGGGCAGGATCGCTCCGGAGAAGGAC
TGGGCCGTGCTGCAGGACTGCAGACATTTCGACCGCCTCACAGTAGACTTCCACCAGAGGGGCGCTGTCGAGGCC
GCACCCGAGGACGATTTGTTCGTCAGACTCTCATACACTGGCGCACATGGCGAAGTGCGCGTCGCGGACATGCCC
AGCCCCGGACAAAATAGGGTGGACTTGAAGGCTGTTTTCGGGTCGGACACGGTTGCCGTCGACGACATCAGGCAC
TTCGACGTTCTTTCTCGCGCTCGCGAGGCCGCAGCGGCCGATGCGGGCGTTCCAGTAGCCGGCGTCACGTTCAGG
GGTCGATGCGCTGGCCCTTTCAAGAAGGAGTTCATCGCAGACAAGTATAAGGAGTTTCACGATTGGTTCGGCAGC
GACGAGAATGCACTGTTGTTCAGACACAGCATCGCCTTGGAAGACTGGCATTTGCTGGATCCAGTGACGAAGCAG
AGAATCAAGGCCGACCGGGAATTTTGA
Gene >Hirsu2|7055
ATGATGCCGGCAGCTCATGAAGCTGACGTCGCTCCAGCGATCCACGGGTGTCAAGCTTTCAACAAGATTACCGTT
TGGCTGCAGATCGCCGGCGACTCCGGCGACGGAACTTGGTCTCAAATATACATGTCTTTCGGGAACCAGGAGTCC
CAGCTCATCAAGATCGCGGACGGTCCTCACGCCGGCGACTGCAGCCATCGGAACATCCCCCTCCAAGCTGCCTAC
GGGACTCCCGTCGTACCTGTCGATCTTGTCACTCAGGTGAGAATCTGGGACGTTTCCGGAGACAGCACCATGGCC
TTTCTTGCAGGAGCAGACGCATGGGTGATTGAGAGTACGCCAACAACATGCTTGACTCGCCTTAAGGCCCTGGAC
CTGAAGGCGATGGAGATTCCAGACTAACGTTTCGTGTTCGCTCAGGCTTGCGGATCGACGCGCAATGCTCGAATC
TACCCAAGACGCTCTCGTATCAGTCCTCGACGATGAGGAGAGAAGTCGCTCACGATAAGCTGCATGTTGATACAC
CGACCCCCGTCTTCACCACCGAACCGATCAAGCCTGAGGACTGGATTGTCCCCCGGGACGTGGCCCCGTCCTGCA
GGAATGACCTGTTAGACACGTCCCTGACCGTGGCATCAACGCAATGCACGGACTTGGAAGAGCTCAAATTGGGCA
TAGAGCTCGGCCATTACAGATACCAAGGGACCTGGGATACCCTGCTTCTCGCCTTTCGGGACACGGACGAGGAAC
ACGTCATTGCGTCCGGCCCCAGCCCCGGCTTTCACGAGTGGCAGAACATCGACCTAATGAGGACGTTCAACCGGC
CGACGGTCGCACTCGACCACATCAAGCAGGTCCAGATCTACCAGAACCGCACCAGCCGCTGGGGAGGAGACGAGT
GGACTCTTCAAGGTATGGGATTCTTGAACCAGACGTGGTATACGCGCTTCGATCGAAAGAAAGTGAGGGCGTCGA
TACATATATTGACCGCCTGGTTCCGTCTTTTCGTGTAGGCATCAAGCTGAAGGGGCGATGCACCGGCTCGCTCAC
CGAGATCGAGCTCGACAAGTTCGCATCGGTCAACCTCGACACGCCGGGGGCCGATACGCAATGGTACCAGGCCAA
GCGGGTTTGGAAGGGCAGGATCGCTCCGGAGAAGGACTGGGCCGTGCTGCAGGACTGCAGACATTTCGACCGCCT
CACAGTAGACTTCCACCAGAGGGGCGCTGTCGAGGCCGCACCCGAGGACGATTTGTTCGTCAGACTCTCATACAC
TGGCGCACATGGCGAAGTGCGCGTCGCGGACATGCCCAGCCCCGGACAAAATAGGGTGGACTTGAAGGCTGTTTT
CGGGTCGGACACGGTTGCCGTCGACGACATCAGGCACTTCGACGTTCTTTCTCGCGCTCGCGAGGCCGCAGCGGC
CGATGCGGGCGTTCCAGGTGTGTTGATCTCTTTCCATGGTGTGCATCGCGAGCGAAGCTCTGACCGTCGCTGTCA
GTAGCCGGCGTCACGTTCAGGGGTCGATGCGCTGGCCCTTTCAAGAAGGAGTTCATCGCAGACAAGTATAAGGAG
TTTCACGATTGGTTCGGCAGCGACGAGAATGCACTGTTGTTCAGACACAGCATCGCCTTGGAAGACTGGCATTTG
CTGGATCCAGTGACGAAGCAGAGAATCAAGGCCGACCGGGAATTTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail