Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|7054
Gene name
LocationContig_391:7716..8746
Strand-
Gene length (bp)1030
Transcript length (bp)963
Coding sequence length (bp)963
Protein length (aa) 321

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF11790 Glyco_hydro_cc Glycosyl hydrolase catalytic core 2.8E-69 26 281

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q09788|ASL1_SCHPO Alkali-sensitive linkage protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=asl1 PE=1 SV=1 24 282 1.0E-12

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 20 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|7054
MIIARLLASLAAASASGWAASSPKRGLCFTPNGHHPEDNQVWVRSGGDLKWYYNYQSLPSPAYAGLSQEEFEYIP
MMWGLGPNPRDTAFLDQVKKLVEDGRKIKHVLAFNEPDTDSSVGGSNIKPRDAAQAWVANFEPLGKMGIKLGLPA
CTGGWGSMPWLKQFLGNCSEMVSAGAEKRNCTWDFLPIHWYDNFAGLASHIGERKAAWPNAEIWVTEYAYAHQDL
GPTQEFYNQTIDYFDKLDYIGRYSYFGAFRASAANVGPNAAFLSNGGRLTDIGSWYLGLGATGVSPQSGNSPAMV
PSTALAGAAVAAALLLSRLL*
Coding >Hirsu2|7054
ATGATCATCGCCAGGCTCTTGGCCTCGCTCGCGGCCGCTTCGGCGAGCGGCTGGGCGGCCTCGTCGCCGAAACGC
GGACTGTGCTTCACGCCCAACGGCCACCACCCCGAGGACAACCAGGTCTGGGTCCGGTCGGGCGGCGATCTGAAA
TGGTACTACAACTACCAGAGCCTCCCCTCGCCGGCCTACGCCGGCCTGTCTCAAGAGGAGTTCGAGTACATCCCG
ATGATGTGGGGGCTCGGCCCGAACCCCCGCGACACGGCCTTCCTGGACCAGGTGAAGAAGCTGGTGGAGGATGGG
CGCAAGATCAAGCACGTGCTGGCCTTCAACGAGCCGGACACCGACTCCAGCGTCGGCGGGAGCAACATCAAGCCC
AGGGACGCGGCCCAGGCCTGGGTCGCCAACTTCGAGCCGCTCGGCAAGATGGGCATCAAGCTCGGGCTGCCGGCC
TGCACCGGCGGATGGGGGAGCATGCCGTGGCTGAAGCAGTTCCTCGGCAACTGCTCCGAGATGGTGAGCGCGGGC
GCGGAGAAGAGGAACTGCACCTGGGACTTCCTCCCGATCCATTGGTACGACAACTTTGCCGGCCTCGCCTCACAC
ATCGGCGAGCGCAAGGCGGCATGGCCCAACGCCGAGATCTGGGTGACGGAGTATGCGTACGCGCACCAAGACCTC
GGCCCGACGCAGGAGTTTTACAACCAGACCATCGACTACTTTGACAAGCTCGACTACATCGGCCGCTATTCCTAC
TTCGGCGCCTTCCGGGCCAGCGCCGCCAACGTCGGGCCCAACGCCGCATTCCTCAGCAACGGCGGCCGGCTGACG
GACATCGGGTCCTGGTACCTGGGGCTAGGCGCCACGGGCGTGAGCCCCCAGAGCGGCAACTCCCCTGCTATGGTG
CCGAGCACGGCGCTGGCGGGAGCTGCCGTCGCCGCCGCGCTGTTGCTTAGCCGCCTCCTCTGA
Transcript >Hirsu2|7054
ATGATCATCGCCAGGCTCTTGGCCTCGCTCGCGGCCGCTTCGGCGAGCGGCTGGGCGGCCTCGTCGCCGAAACGC
GGACTGTGCTTCACGCCCAACGGCCACCACCCCGAGGACAACCAGGTCTGGGTCCGGTCGGGCGGCGATCTGAAA
TGGTACTACAACTACCAGAGCCTCCCCTCGCCGGCCTACGCCGGCCTGTCTCAAGAGGAGTTCGAGTACATCCCG
ATGATGTGGGGGCTCGGCCCGAACCCCCGCGACACGGCCTTCCTGGACCAGGTGAAGAAGCTGGTGGAGGATGGG
CGCAAGATCAAGCACGTGCTGGCCTTCAACGAGCCGGACACCGACTCCAGCGTCGGCGGGAGCAACATCAAGCCC
AGGGACGCGGCCCAGGCCTGGGTCGCCAACTTCGAGCCGCTCGGCAAGATGGGCATCAAGCTCGGGCTGCCGGCC
TGCACCGGCGGATGGGGGAGCATGCCGTGGCTGAAGCAGTTCCTCGGCAACTGCTCCGAGATGGTGAGCGCGGGC
GCGGAGAAGAGGAACTGCACCTGGGACTTCCTCCCGATCCATTGGTACGACAACTTTGCCGGCCTCGCCTCACAC
ATCGGCGAGCGCAAGGCGGCATGGCCCAACGCCGAGATCTGGGTGACGGAGTATGCGTACGCGCACCAAGACCTC
GGCCCGACGCAGGAGTTTTACAACCAGACCATCGACTACTTTGACAAGCTCGACTACATCGGCCGCTATTCCTAC
TTCGGCGCCTTCCGGGCCAGCGCCGCCAACGTCGGGCCCAACGCCGCATTCCTCAGCAACGGCGGCCGGCTGACG
GACATCGGGTCCTGGTACCTGGGGCTAGGCGCCACGGGCGTGAGCCCCCAGAGCGGCAACTCCCCTGCTATGGTG
CCGAGCACGGCGCTGGCGGGAGCTGCCGTCGCCGCCGCGCTGTTGCTTAGCCGCCTCCTCTGA
Gene >Hirsu2|7054
ATGATCATCGCCAGGCTCTTGGCCTCGCTCGCGGCCGCTTCGGCGAGCGGCTGGGCGGCCTCGTCGCCGAAACGC
GGACTGTGCTTCACGCCCAACGGCCACCACCCCGAGGACAACCAGGTCTGGGTCCGGTCGGGCGGCGATCTGAAA
TGGTACTACAACTACCAGAGCCTCCCCTCGCCGGCCTACGCCGGCCTGTCTCAAGAGGAGTTCGAGTACATCCCG
ATGATGTGGGGGCTCGGCCCGAACCCCCGCGACACGGCCTTCCTGGACCAGGTGAAGAAGCTGGTGGAGGATGGG
CGCAAGATCAAGCACGTGCTGGCCTTCAACGAGCCGGACACCGACTCCAGCGTCGGCGGGAGCAACATCAAGCCC
AGGGACGCGGCCCAGGCCTGGGTCGCCAACTTCGAGCCGCTCGGCAAGATGGGCATCAAGCTCGGGCTGCCGGCC
TGCACCGGCGGATGGGGGAGCATGCCGTGGCTGAAGCAGTTCCTCGGCAACTGCTCCGAGATGGTGAGCGCGGGC
GCGGAGAAGAGGAACTGCACCTGGGACTTCCTCCCGATCCATTGGTACGACAACTTTGCCGGCCTCGCCTCACAC
ATCGGCGAGCGCAAGGCGGCGTAAGTGCAGGCCCCCTATGCCCTTCCGTCTACCTGTGTGGCGGCTGAAGCGATC
CGCATGTGACAGATGGCCCAACGCCGAGATCTGGGTGACGGAGTATGCGTACGCGCACCAAGACCTCGGCCCGAC
GCAGGAGTTTTACAACCAGACCATCGACTACTTTGACAAGCTCGACTACATCGGCCGCTATTCCTACTTCGGCGC
CTTCCGGGCCAGCGCCGCCAACGTCGGGCCCAACGCCGCATTCCTCAGCAACGGCGGCCGGCTGACGGACATCGG
GTCCTGGTACCTGGGGCTAGGCGCCACGGGCGTGAGCCCCCAGAGCGGCAACTCCCCTGCTATGGTGCCGAGCAC
GGCGCTGGCGGGAGCTGCCGTCGCCGCCGCGCTGTTGCTTAGCCGCCTCCTCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail